(data stored in ACNUC7421 zone)

EMBL: CP001700.PE18

CP001700.PE18        Location/Qualifiers
FT   CDS             complement(19886..20500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68973"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68973.1"
FT                   /translation="MRIRPVLAVAGSVFLFSSNGFAAHAATQAPSGNSLPATGTAVSLT
FT                   EDGDMVLECNGVLHRFEVLGTGQVRVGARVAGDQPTVAVRTEAEQLTGYDADLGTVTVS
FT                   EKTPADGDFVAPAVGREFPAAESLAQDLTISMQHSPCGGGEPATFTNKAAFPLLNTNMT
FT                   AFPPRNAVFLMTDPVELTDIANPSGPSIMLTEFPLTITQAA"
     MRIRPVLAVA GSVFLFSSNG FAAHAATQAP SGNSLPATGT AVSLTEDGDM VLECNGVLHR        60
     FEVLGTGQVR VGARVAGDQP TVAVRTEAEQ LTGYDADLGT VTVSEKTPAD GDFVAPAVGR       120
     EFPAAESLAQ DLTISMQHSP CGGGEPATFT NKAAFPLLNT NMTAFPPRNA VFLMTDPVEL       180
     TDIANPSGPS IMLTEFPLTI TQAA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page