(data stored in ACNUC7421 zone)

EMBL: CP001700.PE180

CP001700.PE180       Location/Qualifiers
FT   CDS             193634..195694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0180"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: sma:SAV_1715 non-hemolytic phospholipase C;
FT                   TIGRFAM: phospholipase C, phosphocholine-specific; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69135"
FT                   /db_xref="GOA:C7QHJ6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ6"
FT                   /inference="protein motif:TFAM:TIGR03396"
FT                   /protein_id="ACU69135.1"
FT                   /translation="MTAVNRRRFLQITGGTAAATSMPMLTASIARAAAVRPARRTGTIK
FT                   DIEHVVILMQENRSFDHYFGTLRGVRGFGDPRPARLPNGKAVWHQADAAGNEILPWRPT
FT                   GVPDLGLKFLDGLDHSWNGGHHAWNQGNYDQWVPAKGPGTMAHFERQDIPFHFALADAF
FT                   TVCDAYHCSLMTSTDPNRYYLWTGFTGNDGKAGGPVLDNAEAGYDWTTYPERLQAAGVS
FT                   WKIYQDIGTGLDAKGSWGWTDDAYIGNYGDTSVLYFHQYQNAKPGDPLYDNARTGTNAA
FT                   AGQGYFDLLAQDVKNGKLPQVSWITAPEAFSEHPNWPVNYGAWYVSQVLDILSSDEDLW
FT                   SKTALFIMYDENDGFFDHVVPPFVPGGAVGGASTVDTSTEYYSAGAGFDAGSYGLGLRV
FT                   PMFVVSPWSKGGWVDSETFDHTSVIRFLEKRFGVHEPNISPWRRAVCGDLTSAFDFGLR
FT                   ETEVPALPSTASYVPPDHARHSSYPVTLPASASLPKQEAGRRPARALPYDLAADGRIAG
FT                   GALRIGFASRGSAGASFVVTSILDKTGPWSYTVGAGHTLDGSWKLSGAYDYDVRGANGF
FT                   LREFKGDAAKAGLEVVAEHVGNSQNLKLTLTNTGSADVTATVVDSYGCDGKAVLRVRAG
FT                   KHATHVVPAGASDGWYDATVTSDHDAAYVRRFAGHTENGRPSVSDPAIITG"
     MTAVNRRRFL QITGGTAAAT SMPMLTASIA RAAAVRPARR TGTIKDIEHV VILMQENRSF        60
     DHYFGTLRGV RGFGDPRPAR LPNGKAVWHQ ADAAGNEILP WRPTGVPDLG LKFLDGLDHS       120
     WNGGHHAWNQ GNYDQWVPAK GPGTMAHFER QDIPFHFALA DAFTVCDAYH CSLMTSTDPN       180
     RYYLWTGFTG NDGKAGGPVL DNAEAGYDWT TYPERLQAAG VSWKIYQDIG TGLDAKGSWG       240
     WTDDAYIGNY GDTSVLYFHQ YQNAKPGDPL YDNARTGTNA AAGQGYFDLL AQDVKNGKLP       300
     QVSWITAPEA FSEHPNWPVN YGAWYVSQVL DILSSDEDLW SKTALFIMYD ENDGFFDHVV       360
     PPFVPGGAVG GASTVDTSTE YYSAGAGFDA GSYGLGLRVP MFVVSPWSKG GWVDSETFDH       420
     TSVIRFLEKR FGVHEPNISP WRRAVCGDLT SAFDFGLRET EVPALPSTAS YVPPDHARHS       480
     SYPVTLPASA SLPKQEAGRR PARALPYDLA ADGRIAGGAL RIGFASRGSA GASFVVTSIL       540
     DKTGPWSYTV GAGHTLDGSW KLSGAYDYDV RGANGFLREF KGDAAKAGLE VVAEHVGNSQ       600
     NLKLTLTNTG SADVTATVVD SYGCDGKAVL RVRAGKHATH VVPAGASDGW YDATVTSDHD       660
     AAYVRRFAGH TENGRPSVSD PAIITG                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page