(data stored in ACNUC7421 zone)

EMBL: CP001700.PE182

CP001700.PE182       Location/Qualifiers
FT   CDS             196190..196912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GJ22283 gene product from transcript GJ22283-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69137"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69137.1"
FT                   /translation="MTLRTRLSAAAVGALIAVGAVALPAQAATASDPAAGLAKAKAAVT
FT                   EGITDRLTTLGHLQTALTGYKEVTDAARGTLTQVLSSDVSGLTALKTKVAAETTEAAVR
FT                   TDGKTMVDDYRVYVLVAPKVHLTHALDVEGAALAKLVKVHDALADRLAKDPTANTAANK
FT                   ALLADMTSQIQSATTAIAGKDAALLALQPTPDGKALTASVKAISAPAKDARDDIKKAVD
FT                   DAKKVRDALKGTKTTTKS"
     MTLRTRLSAA AVGALIAVGA VALPAQAATA SDPAAGLAKA KAAVTEGITD RLTTLGHLQT        60
     ALTGYKEVTD AARGTLTQVL SSDVSGLTAL KTKVAAETTE AAVRTDGKTM VDDYRVYVLV       120
     APKVHLTHAL DVEGAALAKL VKVHDALADR LAKDPTANTA ANKALLADMT SQIQSATTAI       180
     AGKDAALLAL QPTPDGKALT ASVKAISAPA KDARDDIKKA VDDAKKVRDA LKGTKTTTKS       240
//

If you have problems or comments...

PBIL Back to PBIL home page