(data stored in ACNUC7421 zone)

EMBL: CP001700.PE183

CP001700.PE183       Location/Qualifiers
FT   CDS             complement(197393..197938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_2083 putative outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69138"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69138.1"
FT                   /translation="MAFLKNATVIAALASAGVVGMAGIASAAADDAWNGGAEHHKTGDN
FT                   NVGQGGLIPVNALNNVNVSPNLGCLAHNTVPDLNVQSLVGLVPIGVGLNHLLEHTHLNV
FT                   LSNGNIDTDVNDNSCTSNQGSSQAGNNSRGSVGAGDSSSSHSTGDGAGSQNNGAGAGAG
FT                   GLIGSSGLLGKGGLNLGG"
     MAFLKNATVI AALASAGVVG MAGIASAAAD DAWNGGAEHH KTGDNNVGQG GLIPVNALNN        60
     VNVSPNLGCL AHNTVPDLNV QSLVGLVPIG VGLNHLLEHT HLNVLSNGNI DTDVNDNSCT       120
     SNQGSSQAGN NSRGSVGAGD SSSSHSTGDG AGSQNNGAGA GAGGLIGSSG LLGKGGLNLG       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page