(data stored in ACNUC7421 zone)

EMBL: CP001700.PE185

CP001700.PE185       Location/Qualifiers
FT   CDS             complement(198853..199518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmo:HM1_1325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69140"
FT                   /db_xref="UniProtKB/TrEMBL:C7QIZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69140.1"
FT                   /translation="MRKYLSLAVVALSSGGALFAAAGAASAATSTDSLRAAPWQATSPL
FT                   AMHAAPFGDHDVMGLCGMQRDNVRTGQIDADLVQKLCAGEGDMMTPPVPGPPPVMTPPP
FT                   PPMGSPSPCTEVCKPVHHHHPKPPTPPTHPTPPPPPPVTQPCPPPPCPPVTPPPPPPCP
FT                   PVMPPPPVPCPPPTPNPCPPGHEHGWSAEPDAATQAAPAAGNAVAGLPILGSVAGGLL"
     MRKYLSLAVV ALSSGGALFA AAGAASAATS TDSLRAAPWQ ATSPLAMHAA PFGDHDVMGL        60
     CGMQRDNVRT GQIDADLVQK LCAGEGDMMT PPVPGPPPVM TPPPPPMGSP SPCTEVCKPV       120
     HHHHPKPPTP PTHPTPPPPP PVTQPCPPPP CPPVTPPPPP PCPPVMPPPP VPCPPPTPNP       180
     CPPGHEHGWS AEPDAATQAA PAAGNAVAGL PILGSVAGGL L                           221
//

If you have problems or comments...

PBIL Back to PBIL home page