(data stored in ACNUC7421 zone)

EMBL: CP001700.PE187

CP001700.PE187       Location/Qualifiers
FT   CDS             complement(200393..201403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69142"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ00"
FT                   /inference="similar to AA sequence:KEGG:SAV_3557"
FT                   /protein_id="ACU69142.1"
FT                   /translation="MAQASAQRHGIPNGQFAGRIIEFSDPELDRKFPHGIYLTMHGYPE
FT                   FAVYARHTVQIADPPSGLSVDEIRVTDVIAANLLAADAGDPLWQTRPNTATPQGWTWAH
FT                   AAESRMLHCVPIELHGAFRHHGGMATLKADRGRSGLFTEGMLEPVAFERSGSVPEDAMA
FT                   QLEQHLGFALPPSYRRFLAGTDGGRPISPAVNLAGGFVADQWMFGLRREDPHQDLVYAN
FT                   QALYDRFTEEYLGIGYVQGGMLALKIRGAEAGSVWLFDDDDPRDSESRDAGSVCAELLK
FT                   KIGSDFDDFARHLVALPQQIVDIARSAVDSGHAKSITDIEHLGAALPEGLKAPRR"
     MAQASAQRHG IPNGQFAGRI IEFSDPELDR KFPHGIYLTM HGYPEFAVYA RHTVQIADPP        60
     SGLSVDEIRV TDVIAANLLA ADAGDPLWQT RPNTATPQGW TWAHAAESRM LHCVPIELHG       120
     AFRHHGGMAT LKADRGRSGL FTEGMLEPVA FERSGSVPED AMAQLEQHLG FALPPSYRRF       180
     LAGTDGGRPI SPAVNLAGGF VADQWMFGLR REDPHQDLVY ANQALYDRFT EEYLGIGYVQ       240
     GGMLALKIRG AEAGSVWLFD DDDPRDSESR DAGSVCAELL KKIGSDFDDF ARHLVALPQQ       300
     IVDIARSAVD SGHAKSITDI EHLGAALPEG LKAPRR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page