(data stored in ACNUC7421 zone)

EMBL: CP001700.PE188

CP001700.PE188       Location/Qualifiers
FT   CDS             201624..205172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0188"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: sma:SAV_3549 transcriptional-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69143"
FT                   /db_xref="GOA:C7QJ01"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ01"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACU69143.1"
FT                   /translation="MSLSGLLDAVSADPGVAALLEAAATAGRTSFDLAAPRSVRPFALA
FT                   ALARAQGPAGRPVLAVTATGREAEDLVAALRGLLDPETVVDFPSWETLPHERLSPRSDT
FT                   VGRRLAVLRRLVHPDAATEGAGALKVVVAPIRSVLQPQVKGLADLVPVAARTGAEIDLD
FT                   DLVNRLAAAAYTRTDLVDKRGEFAVRGGIVDVFPPTEEHPLRLEFWGDQIEEIRYFKVA
FT                   DQRSLEVAEHGLWAPPCRELLLTDEVRKRAAALMEDHPELADILGKVSEGIGVEGMESL
FT                   APVLVDDMELLIDLLPAGSPIVLCDPERVRTRAADLAATSAEFLDASWAATAGGGQTPI
FT                   DLGAASLKDLASVREHAITLGLPWWSLTPFAPDLELLPEEDATEISEIHDTEQYGGDTG
FT                   RALADVRARISEGWRVVLVTQGHGSADRLVEVLKGADIGARYVPELDTVPEPALATVAT
FT                   ASIEHGFIAADLKLWVITEQDVSGQRTATKDMSRMPSRRRNVIDPLQLKAGDPVVHEQH
FT                   GVGRYVEMAQRTVAGATREYLVIEYAAAKRGQPGDRLFVPTDQLDQVTKYVGGEAPSLH
FT                   RLGGADWQKAKSRARKAVKQIAGDLVKLYSARMAAPGHAFAADTPWQRELEDAFPYVET
FT                   PDQLACIDEVKSDMEKPVPMDRLICGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPTTLL
FT                   VQQHFSTFAERYAQFPVTLKGLSRFQTDKEAAEVLRGVADGSVDVVIGTHRLLANSVKF
FT                   KRLGLVIVDEEQRFGVEHKEQLKQARANVDVLTMSATPIPRTLEMAVTGIREMSTIQTP
FT                   PEERHPVLTFVGPYEERQISAAIRRELLREGQAFYIHNRVESIDRAASRLRALVPEARI
FT                   ATAHGQMNEHVLEKLIVDFWNKEYDVLVCTTIVESGIDITNANTLIVERADNFGLSQLH
FT                   QLRGRVGRGRERAYSYFTYPPEKPLTETAHERLATIAQHTDLGAGMYVAMKDLEIRGAG
FT                   NLLGGEQSGHIEGVGFDLYIRMVGEAVEEYRAQAEGREVEEQVEIRVDLPVDAHLPHDY
FT                   IPGERLRLEAYKRIAGATTHEELAEVRQEFTDRYGRFPQPVENLLAVAAFRIDARAAGL
FT                   TEVAVQGNFVKFGPVKLRESQEMRLLRLFPKTLVKAATDTMLVPKPMTARIGGQPLRDQ
FT                   ELLGWARDLIDAVLKM"
     MSLSGLLDAV SADPGVAALL EAAATAGRTS FDLAAPRSVR PFALAALARA QGPAGRPVLA        60
     VTATGREAED LVAALRGLLD PETVVDFPSW ETLPHERLSP RSDTVGRRLA VLRRLVHPDA       120
     ATEGAGALKV VVAPIRSVLQ PQVKGLADLV PVAARTGAEI DLDDLVNRLA AAAYTRTDLV       180
     DKRGEFAVRG GIVDVFPPTE EHPLRLEFWG DQIEEIRYFK VADQRSLEVA EHGLWAPPCR       240
     ELLLTDEVRK RAAALMEDHP ELADILGKVS EGIGVEGMES LAPVLVDDME LLIDLLPAGS       300
     PIVLCDPERV RTRAADLAAT SAEFLDASWA ATAGGGQTPI DLGAASLKDL ASVREHAITL       360
     GLPWWSLTPF APDLELLPEE DATEISEIHD TEQYGGDTGR ALADVRARIS EGWRVVLVTQ       420
     GHGSADRLVE VLKGADIGAR YVPELDTVPE PALATVATAS IEHGFIAADL KLWVITEQDV       480
     SGQRTATKDM SRMPSRRRNV IDPLQLKAGD PVVHEQHGVG RYVEMAQRTV AGATREYLVI       540
     EYAAAKRGQP GDRLFVPTDQ LDQVTKYVGG EAPSLHRLGG ADWQKAKSRA RKAVKQIAGD       600
     LVKLYSARMA APGHAFAADT PWQRELEDAF PYVETPDQLA CIDEVKSDME KPVPMDRLIC       660
     GDVGYGKTEI AVRAAFKAVQ DGKQVAVLVP TTLLVQQHFS TFAERYAQFP VTLKGLSRFQ       720
     TDKEAAEVLR GVADGSVDVV IGTHRLLANS VKFKRLGLVI VDEEQRFGVE HKEQLKQARA       780
     NVDVLTMSAT PIPRTLEMAV TGIREMSTIQ TPPEERHPVL TFVGPYEERQ ISAAIRRELL       840
     REGQAFYIHN RVESIDRAAS RLRALVPEAR IATAHGQMNE HVLEKLIVDF WNKEYDVLVC       900
     TTIVESGIDI TNANTLIVER ADNFGLSQLH QLRGRVGRGR ERAYSYFTYP PEKPLTETAH       960
     ERLATIAQHT DLGAGMYVAM KDLEIRGAGN LLGGEQSGHI EGVGFDLYIR MVGEAVEEYR      1020
     AQAEGREVEE QVEIRVDLPV DAHLPHDYIP GERLRLEAYK RIAGATTHEE LAEVRQEFTD      1080
     RYGRFPQPVE NLLAVAAFRI DARAAGLTEV AVQGNFVKFG PVKLRESQEM RLLRLFPKTL      1140
     VKAATDTMLV PKPMTARIGG QPLRDQELLG WARDLIDAVL KM                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page