(data stored in ACNUC7421 zone)

EMBL: CP001700.PE189

CP001700.PE189       Location/Qualifiers
FT   CDS             205284..206531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0189"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4255 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69144"
FT                   /db_xref="GOA:C7QJ02"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ02"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69144.1"
FT                   /translation="MDATDRLPSQVKALIVARAVNQLGGFSLAFLTVLLTRSFGTSLTT
FT                   AGIVSAAFGLATIPSRLAGGRLADHWGRRRTIVAGLVALAVAQLGLAAAPDLITATICA
FT                   VAMGLAFELFEPPSQATIADAVPPARRASAFELLTTAVAAGSLAAGVIADIVGRWSLRW
FT                   LFVVDAGTGLACAAIVALALAPDAVRKPEHGAESDQPATSAISPWRDPALLIATVSGTV
FT                   FALVSMLMLSALPLALGAVGLNPASAGLIMAASTGTLVLARPVLRRRWLAELPHSATFV
FT                   LGYLLMAAGLCGYAVAHTLPALLVPTALYSLGNLLVLGRSFAVVSELAPASASARYLAV
FT                   YGLSWGVATLLAPLVGTWLIGVSGAGLLWGVSAGVCGVMAVAQPWVVRRVRDSQRDLGV
FT                   IHSTKAAVDRYDAVSI"
     MDATDRLPSQ VKALIVARAV NQLGGFSLAF LTVLLTRSFG TSLTTAGIVS AAFGLATIPS        60
     RLAGGRLADH WGRRRTIVAG LVALAVAQLG LAAAPDLITA TICAVAMGLA FELFEPPSQA       120
     TIADAVPPAR RASAFELLTT AVAAGSLAAG VIADIVGRWS LRWLFVVDAG TGLACAAIVA       180
     LALAPDAVRK PEHGAESDQP ATSAISPWRD PALLIATVSG TVFALVSMLM LSALPLALGA       240
     VGLNPASAGL IMAASTGTLV LARPVLRRRW LAELPHSATF VLGYLLMAAG LCGYAVAHTL       300
     PALLVPTALY SLGNLLVLGR SFAVVSELAP ASASARYLAV YGLSWGVATL LAPLVGTWLI       360
     GVSGAGLLWG VSAGVCGVMA VAQPWVVRRV RDSQRDLGVI HSTKAAVDRY DAVSI            415
//

If you have problems or comments...

PBIL Back to PBIL home page