(data stored in ACNUC7421 zone)

EMBL: CP001700.PE19

CP001700.PE19        Location/Qualifiers
FT   CDS             complement(20593..21360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0019"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68974"
FT                   /db_xref="GOA:C7QFN5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68974.1"
FT                   /translation="MSYWSRSFPGLAENLAEVRQFIQMVLGDAPGAELVVLAGSELAGN
FT                   AIVHTASGAPGGQFVVHLAAFADRWQVRVDDAGSPTEPRVLVDSMDEHCDWDSESGRGL
FT                   AMVASISRKWGVLGDRAARAVWAEIPCPVPPGGGIESVMSGGMLEALESVARALENENR
FT                   PPYQELDTSSATAPATAAVPSVAIAPARWPGTMPSDPARAERIRRQASHAAFQRALIES
FT                   AYAETLGPRPLPYWPPFPNPLALQGSSPGTRPR"
     MSYWSRSFPG LAENLAEVRQ FIQMVLGDAP GAELVVLAGS ELAGNAIVHT ASGAPGGQFV        60
     VHLAAFADRW QVRVDDAGSP TEPRVLVDSM DEHCDWDSES GRGLAMVASI SRKWGVLGDR       120
     AARAVWAEIP CPVPPGGGIE SVMSGGMLEA LESVARALEN ENRPPYQELD TSSATAPATA       180
     AVPSVAIAPA RWPGTMPSDP ARAERIRRQA SHAAFQRALI ESAYAETLGP RPLPYWPPFP       240
     NPLALQGSSP GTRPR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page