(data stored in ACNUC7421 zone)

EMBL: CP001700.PE190

CP001700.PE190       Location/Qualifiers
FT   CDS             206576..207328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0190"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sma:SAV_3538 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69145"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ03"
FT                   /inference="similar to AA sequence:KEGG:SAV_3538"
FT                   /protein_id="ACU69145.1"
FT                   /translation="MIQARSVRLAAVIVLGGAVALATSACGGPMQAGAAAVVQGQRTTD
FT                   ATVQDQVASIVSLVQHNNLQQGDVTDEERSALAKAQINLLVQQAVWQKVADDNGVKVTA
FT                   ADDAKEHSALVEQARGSLQGTKFTGSDNEAVALADAESQQNSSGLAPSSVPVYSHIQAL
FT                   VTAVIDDQATKLRVDPNDQNSLPALQGAILPMLSKASTQIDVKISPRYGSFDASTRQVV
FT                   AAQTSWIRPTKAQVAAAAAAQAQQQQSQ"
     MIQARSVRLA AVIVLGGAVA LATSACGGPM QAGAAAVVQG QRTTDATVQD QVASIVSLVQ        60
     HNNLQQGDVT DEERSALAKA QINLLVQQAV WQKVADDNGV KVTAADDAKE HSALVEQARG       120
     SLQGTKFTGS DNEAVALADA ESQQNSSGLA PSSVPVYSHI QALVTAVIDD QATKLRVDPN       180
     DQNSLPALQG AILPMLSKAS TQIDVKISPR YGSFDASTRQ VVAAQTSWIR PTKAQVAAAA       240
     AAQAQQQQSQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page