(data stored in ACNUC7421 zone)

EMBL: CP001700.PE191

CP001700.PE191       Location/Qualifiers
FT   CDS             complement(207411..208415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69146"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ04"
FT                   /inference="similar to AA sequence:KEGG:SCO7720"
FT                   /protein_id="ACU69146.1"
FT                   /translation="MRGKGVNYDTGFFPGGQDSRPDFDPETARRELRVIAEDLHCTAVR
FT                   ISGALPDRLEAAAQAAADAGLEVWFAPFPCEASREDLLELLADCAQRAERLRAAGAEVV
FT                   FVAGCETSLFCPGYFDGDDSYARIETLGNGGMALWSRLGEIMASFNGYLVEAAATVREH
FT                   FQGKVTYAAGPWEFIDWAPFDFVSVDAYRSAENRDKFADQIRAHFKHGKPVVATEFGCT
FT                   PYVGSGDRGGMAWAILDDSVEPPVVNGDYLRSEDEQSAYFTELYDVFEEAGVDSAFWFT
FT                   FATFRALHDPSDPRKDLDLAAYGTVKMTGPDTPELNWEPKKVFHTIAERYAAS"
     MRGKGVNYDT GFFPGGQDSR PDFDPETARR ELRVIAEDLH CTAVRISGAL PDRLEAAAQA        60
     AADAGLEVWF APFPCEASRE DLLELLADCA QRAERLRAAG AEVVFVAGCE TSLFCPGYFD       120
     GDDSYARIET LGNGGMALWS RLGEIMASFN GYLVEAAATV REHFQGKVTY AAGPWEFIDW       180
     APFDFVSVDA YRSAENRDKF ADQIRAHFKH GKPVVATEFG CTPYVGSGDR GGMAWAILDD       240
     SVEPPVVNGD YLRSEDEQSA YFTELYDVFE EAGVDSAFWF TFATFRALHD PSDPRKDLDL       300
     AAYGTVKMTG PDTPELNWEP KKVFHTIAER YAAS                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page