(data stored in ACNUC7421 zone)

EMBL: CP001700.PE192

CP001700.PE192       Location/Qualifiers
FT   CDS             complement(208489..209226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69147"
FT                   /db_xref="GOA:C7QJ05"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ05"
FT                   /inference="similar to AA sequence:KEGG:SAV_4727"
FT                   /protein_id="ACU69147.1"
FT                   /translation="MTAMTAHTHRTADVTADGAGVADVADGETPHPLKQALLPLAVDIA
FT                   IPLGSYYALHAGLGMSNAAALGLSSVVPAIRTIVAAVGKRQANALAALMLTVNIVAIAL
FT                   TFVSGDARLMLAKDSGVSSVIALGILWSVRGGKPMMSAGLKPFVTKGDAKQTAAWDALR
FT                   IESSTFRAKENLYSVIWGAWLLTECLARLAGAFLLPVSTMAWLGTVILIVAIAGACVTG
FT                   GAAVEPLEKLVAAHVEAASDAEH"
     MTAMTAHTHR TADVTADGAG VADVADGETP HPLKQALLPL AVDIAIPLGS YYALHAGLGM        60
     SNAAALGLSS VVPAIRTIVA AVGKRQANAL AALMLTVNIV AIALTFVSGD ARLMLAKDSG       120
     VSSVIALGIL WSVRGGKPMM SAGLKPFVTK GDAKQTAAWD ALRIESSTFR AKENLYSVIW       180
     GAWLLTECLA RLAGAFLLPV STMAWLGTVI LIVAIAGACV TGGAAVEPLE KLVAAHVEAA       240
     SDAEH                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page