(data stored in ACNUC7421 zone)

EMBL: CP001700.PE193

CP001700.PE193       Location/Qualifiers
FT   CDS             209307..209954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0193"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO4450
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69148"
FT                   /db_xref="GOA:C7QJ06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ06"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69148.1"
FT                   /translation="METQGLRERKKRQTREEIANVATALFAELGFEKVTIAEVAAAAGV
FT                   AKMTVTNHFPLKEDLVFDRAEHIVHGLPDAVAARPDGEPVLAAARRYHAQQLAAGDPTL
FT                   GHRGVDFSRMVESSPALAARERQIHDQREQALAEVLVAQTRPAEELTARVAAAQIAGVY
FT                   RVLYFTARRFLLDGLQGPEMAETLGACAQRAFTLLEVDLSGFDPRPRLRSTA"
     METQGLRERK KRQTREEIAN VATALFAELG FEKVTIAEVA AAAGVAKMTV TNHFPLKEDL        60
     VFDRAEHIVH GLPDAVAARP DGEPVLAAAR RYHAQQLAAG DPTLGHRGVD FSRMVESSPA       120
     LAARERQIHD QREQALAEVL VAQTRPAEEL TARVAAAQIA GVYRVLYFTA RRFLLDGLQG       180
     PEMAETLGAC AQRAFTLLEV DLSGFDPRPR LRSTA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page