(data stored in ACNUC7421 zone)

EMBL: CP001700.PE194

CP001700.PE194       Location/Qualifiers
FT   CDS             209951..211027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0194"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: sgr:SGR_4434 MazG family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69149"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ07"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACU69149.1"
FT                   /translation="MTEAPPPDPENPQGPENSGRIVFLATSPRVALGLLSWPAWETLRA
FT                   ADVVFAGDADHPHIPYVEQATGAVVALPDHSPSMAAERLLEAATPARTVVWLAEDEEYD
FT                   EELAVALGNRLVLLASADLPELEVLPGSYDLPGAHLLDLVDVMNRLRSPGGCPWDAEQT
FT                   HASLVKYLLEEAYETVETIEDGDPLTPGPGRDALREELGDVLLQVMFHSRIAEEHEADP
FT                   FSVDDVADGIVAKLIRRHPHVFADVEAPTAEHVAANWEQIKAAEKQRESVTEGVPMTQP
FT                   ALALVAKLAGRVRKSGLVVPAGPAPDLPDTADELGEQLLATAIKAVGAGWDPEEALRTA
FT                   ARRYRDRVITAEEELARG"
     MTEAPPPDPE NPQGPENSGR IVFLATSPRV ALGLLSWPAW ETLRAADVVF AGDADHPHIP        60
     YVEQATGAVV ALPDHSPSMA AERLLEAATP ARTVVWLAED EEYDEELAVA LGNRLVLLAS       120
     ADLPELEVLP GSYDLPGAHL LDLVDVMNRL RSPGGCPWDA EQTHASLVKY LLEEAYETVE       180
     TIEDGDPLTP GPGRDALREE LGDVLLQVMF HSRIAEEHEA DPFSVDDVAD GIVAKLIRRH       240
     PHVFADVEAP TAEHVAANWE QIKAAEKQRE SVTEGVPMTQ PALALVAKLA GRVRKSGLVV       300
     PAGPAPDLPD TADELGEQLL ATAIKAVGAG WDPEEALRTA ARRYRDRVIT AEEELARG         358
//

If you have problems or comments...

PBIL Back to PBIL home page