(data stored in ACNUC7421 zone)

EMBL: CP001700.PE195

CP001700.PE195       Location/Qualifiers
FT   CDS             211121..211381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0195"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: mle:ML1331 twin argininte translocase
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69150"
FT                   /db_xref="GOA:C7QJ08"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ08"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACU69150.1"
FT                   /translation="MGDLQPWHIIVILVVVFLLFGAKKMPDMARSVGQSLRIFKSEMRQ
FT                   SQKETEEVAKQANDSVRVTPAVENSGSVPASDAAEKHTSAT"
     MGDLQPWHII VILVVVFLLF GAKKMPDMAR SVGQSLRIFK SEMRQSQKET EEVAKQANDS        60
     VRVTPAVENS GSVPASDAAE KHTSAT                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page