(data stored in ACNUC7421 zone)

EMBL: CP001700.PE196

CP001700.PE196       Location/Qualifiers
FT   CDS             complement(211522..212493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69151"
FT                   /db_xref="GOA:C7QJ09"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69151.1"
FT                   /translation="MPPQDWAPPMPPQQDRVPPMPQPDRGPYPQFTQQPPPPQFTPPQM
FT                   PGMPYPDEEPPPRKNTGRIIAGVVAGVVLLGGAGGIYLLTKGDSKKDTKPQPVAAATSA
FT                   TTPATTPAAPGTPASSGATSFPNNSYTGSAAAPPASASSTGGGATLDNAATDKTPFTAQ
FT                   ALVAQSFTDDKNVAYALKSAQPQPCAKVGDAAVQTIVKSAKCTDFMAASWIDPANSRIV
FT                   VSAMVIPYQDAATATAIYKKLSTTHTGDYAQWCPPAGQPGADTCAKLAKAGAVTREGKF
FT                   GSFHRYVLITTAVYADLRNDDSQKDWLTSAAHGAFQNTLPGQ"
     MPPQDWAPPM PPQQDRVPPM PQPDRGPYPQ FTQQPPPPQF TPPQMPGMPY PDEEPPPRKN        60
     TGRIIAGVVA GVVLLGGAGG IYLLTKGDSK KDTKPQPVAA ATSATTPATT PAAPGTPASS       120
     GATSFPNNSY TGSAAAPPAS ASSTGGGATL DNAATDKTPF TAQALVAQSF TDDKNVAYAL       180
     KSAQPQPCAK VGDAAVQTIV KSAKCTDFMA ASWIDPANSR IVVSAMVIPY QDAATATAIY       240
     KKLSTTHTGD YAQWCPPAGQ PGADTCAKLA KAGAVTREGK FGSFHRYVLI TTAVYADLRN       300
     DDSQKDWLTS AAHGAFQNTL PGQ                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page