(data stored in ACNUC7421 zone)

EMBL: CP001700.PE197

CP001700.PE197       Location/Qualifiers
FT   CDS             212732..214468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0197"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   ace:Acel_1952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69152"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ10"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ACU69152.1"
FT                   /translation="MADTPDARFEALAADILDGLWRRHPDWAGTVGLHEYDAELPDRSA
FT                   GGLAAEAAWLAGRAEDLADLDPAALSVPNRVDAAILANQLAALRFQIEDLREDEWNPAE
FT                   ANPGVALYTLLARDYAPAAQRLSAFAGRLEQVPSALLDNRSLLAGKPLSRIHVELAIGQ
FT                   FEGTVDLIGAELDAAVAAASEAASKAGSEADSEAVSQARKAIDAVRPDASAALQEHIVW
FT                   LKERLAAGDAGEEEFRDPRIGAELFTRKLSLSLDAESDAAAILARAEADLDRVSAEIAE
FT                   AAADYEGVAVPSDEAERSALVRRVLDRLAESAPDNETILEYSRQALLAQFAFVRDHDLV
FT                   TVYPDPYEVVEMPEVHRGVSVAYCDPPGPMEPAEVQTILAISPTPEGWTQERVDSFFRE
FT                   YNRHMLHNLMVHEAMPGHLLQLQHSRRQQAPTSVRAALWSGSFVEGWAVYAEALMARHG
FT                   YPGDGDPRAVRMQQLKMQIRMIINTVLDSRIHCHGMTEDEAMALMTGRGYQEDGEAAGK
FT                   WRRALLSSTQLSTYYVGYKEVSDLVRDLRADHPEWSERQVHDAVLGHGSPPARYLRDLI
FT                   AA"
     MADTPDARFE ALAADILDGL WRRHPDWAGT VGLHEYDAEL PDRSAGGLAA EAAWLAGRAE        60
     DLADLDPAAL SVPNRVDAAI LANQLAALRF QIEDLREDEW NPAEANPGVA LYTLLARDYA       120
     PAAQRLSAFA GRLEQVPSAL LDNRSLLAGK PLSRIHVELA IGQFEGTVDL IGAELDAAVA       180
     AASEAASKAG SEADSEAVSQ ARKAIDAVRP DASAALQEHI VWLKERLAAG DAGEEEFRDP       240
     RIGAELFTRK LSLSLDAESD AAAILARAEA DLDRVSAEIA EAAADYEGVA VPSDEAERSA       300
     LVRRVLDRLA ESAPDNETIL EYSRQALLAQ FAFVRDHDLV TVYPDPYEVV EMPEVHRGVS       360
     VAYCDPPGPM EPAEVQTILA ISPTPEGWTQ ERVDSFFREY NRHMLHNLMV HEAMPGHLLQ       420
     LQHSRRQQAP TSVRAALWSG SFVEGWAVYA EALMARHGYP GDGDPRAVRM QQLKMQIRMI       480
     INTVLDSRIH CHGMTEDEAM ALMTGRGYQE DGEAAGKWRR ALLSSTQLST YYVGYKEVSD       540
     LVRDLRADHP EWSERQVHDA VLGHGSPPAR YLRDLIAA                               578
//

If you have problems or comments...

PBIL Back to PBIL home page