(data stored in ACNUC7421 zone)

EMBL: CP001700.PE199

CP001700.PE199       Location/Qualifiers
FT   CDS             complement(215132..216490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0199"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sma:SAV_4879 two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69154"
FT                   /db_xref="GOA:C7QJ12"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ12"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU69154.1"
FT                   /translation="MITTVGAKAAARREGDTAPTLGPGELLKGPFTGRALRQQGYLLVS
FT                   FVAAFVQVLVLTVTLALGGALVVLVVGLPLLLAGLVSLRWNSRRERLRILRLTGERVPE
FT                   PYREPGPSGNPLQRLLGHLSDPATWRDLVHLVVASGLGLGWFLVAVGSWVLPLGAVTLP
FT                   FWYTALPEHRIPLMHVNGSEYYISTLPSILAFSAVTLAFVWLVNPTLLELGTRTQTGLG
FT                   RALLGLSRLELDRRETALRTTRSQAVSAAEAERRRIERDLHDGAQQRLVALAMDLGRAK
FT                   SKLKTGDEADSEAAAQLVAEAHEGVKLALSELRDLARGIHPAVLTDRGLDAALSALAGR
FT                   SPIPVEVDADLPWRPSPEVESAAYFVASEALANMAKHAHATRAWIELEIREDHLRMIVG
FT                   DNGVGGAQTDPGGGLDGLSDRIAPLDGILSVSSPLGGPTQIIMEMPCPNPSAS"
     MITTVGAKAA ARREGDTAPT LGPGELLKGP FTGRALRQQG YLLVSFVAAF VQVLVLTVTL        60
     ALGGALVVLV VGLPLLLAGL VSLRWNSRRE RLRILRLTGE RVPEPYREPG PSGNPLQRLL       120
     GHLSDPATWR DLVHLVVASG LGLGWFLVAV GSWVLPLGAV TLPFWYTALP EHRIPLMHVN       180
     GSEYYISTLP SILAFSAVTL AFVWLVNPTL LELGTRTQTG LGRALLGLSR LELDRRETAL       240
     RTTRSQAVSA AEAERRRIER DLHDGAQQRL VALAMDLGRA KSKLKTGDEA DSEAAAQLVA       300
     EAHEGVKLAL SELRDLARGI HPAVLTDRGL DAALSALAGR SPIPVEVDAD LPWRPSPEVE       360
     SAAYFVASEA LANMAKHAHA TRAWIELEIR EDHLRMIVGD NGVGGAQTDP GGGLDGLSDR       420
     IAPLDGILSV SSPLGGPTQI IMEMPCPNPS AS                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page