(data stored in ACNUC7421 zone)

EMBL: CP001700.PE2

CP001700.PE2         Location/Qualifiers
FT   CDS             2834..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sco:SCO3878 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68957"
FT                   /db_xref="GOA:C7QFL8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU68957.1"
FT                   /translation="MKFRVERDVLSEAVAWTARSLPSRPAAPVLAGLVFEAVEGEGGED
FT                   HGSVTLSGFDYEVSSRAQIGADVTEPGRILIHGKLLADIAKSLPNRPVEFSTEGSKVLL
FT                   SCGSSRFTLQTLPVEDYPALPTMPTATGAVTASGLAGAVSQVAIAAGRDDTIPMLTGIR
FT                   VEIEGEKITLVATDRFRLAVRELQWKPEQDDMSATALIPSKVLSDTAKALTGGDWVSLA
FT                   LSGGDAGEGLIGFESGEGTSGKAKGSRRMTSRLLSGEFVKYRSLFPNEYNITATVETAP
FT                   FLEAAKRVSLVADRTSPIKLAFTQGEVTLEAGAGDEAQASEAMDAVLDGEDISVSFNPS
FT                   FLLDGLQVIDTQYAQLSFTVASKPAVLMGRPALDAPAQEEFRYLMMPLRVPGQSAG"
     MKFRVERDVL SEAVAWTARS LPSRPAAPVL AGLVFEAVEG EGGEDHGSVT LSGFDYEVSS        60
     RAQIGADVTE PGRILIHGKL LADIAKSLPN RPVEFSTEGS KVLLSCGSSR FTLQTLPVED       120
     YPALPTMPTA TGAVTASGLA GAVSQVAIAA GRDDTIPMLT GIRVEIEGEK ITLVATDRFR       180
     LAVRELQWKP EQDDMSATAL IPSKVLSDTA KALTGGDWVS LALSGGDAGE GLIGFESGEG       240
     TSGKAKGSRR MTSRLLSGEF VKYRSLFPNE YNITATVETA PFLEAAKRVS LVADRTSPIK       300
     LAFTQGEVTL EAGAGDEAQA SEAMDAVLDG EDISVSFNPS FLLDGLQVID TQYAQLSFTV       360
     ASKPAVLMGR PALDAPAQEE FRYLMMPLRV PGQSAG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page