(data stored in ACNUC7421 zone)

EMBL: CP001700.PE200

CP001700.PE200       Location/Qualifiers
FT   CDS             216643..217491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0200"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: rha:RHA1_ro00243
FT                   ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69155"
FT                   /db_xref="GOA:C7QJ13"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ13"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ACU69155.1"
FT                   /translation="MEELPTLPVLIARIESSHPFSDPLARLADAVETGASISALADHLV
FT                   GHFVDEARAAGASWAQIGVALGVSKQAVQQRFVPREPATVADFDIEVQRFSRFTPRCLN
FT                   CVLGAEKIAVATGAAAVTPTHILIGLFVEPQSLAIHALADNGADPAQVRAAAVETLPPA
FT                   PEGATVLATATATAPSQEPAIPGNSLPFTPEARKTFDLAVRAALSAGHNYVGTEHLLLA
FT                   LAGDPKSETALLLTSFGLTRDGLEASVQRLLMEFMANSGRRGSGVSPLDPAEQGAPPAE
FT                   G"
     MEELPTLPVL IARIESSHPF SDPLARLADA VETGASISAL ADHLVGHFVD EARAAGASWA        60
     QIGVALGVSK QAVQQRFVPR EPATVADFDI EVQRFSRFTP RCLNCVLGAE KIAVATGAAA       120
     VTPTHILIGL FVEPQSLAIH ALADNGADPA QVRAAAVETL PPAPEGATVL ATATATAPSQ       180
     EPAIPGNSLP FTPEARKTFD LAVRAALSAG HNYVGTEHLL LALAGDPKSE TALLLTSFGL       240
     TRDGLEASVQ RLLMEFMANS GRRGSGVSPL DPAEQGAPPA EG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page