(data stored in ACNUC7421 zone)

EMBL: CP001700.PE201

CP001700.PE201       Location/Qualifiers
FT   CDS             217533..218819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0201"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: sgr:SGR_4439 putative enolase; TIGRFAM:
FT                   enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69156"
FT                   /db_xref="GOA:C7QJ14"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ14"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACU69156.1"
FT                   /translation="MASIEAINAREILDSRGNPTVEVEVLLEDGSFARAAVPSGASTGA
FT                   FEAVELRDGDAARYGGKGVERAVQGVLDEIYPAVVGEDASDQRLIDQAMIDLDATPNKA
FT                   RLGANALLGVSLAVAKAAAESAELPLFRYLGGPNAHTLPVPMMNILNGGAHADSNVDIQ
FT                   EFMIAPIGAGSFREALRWGAEVYHALKSVLKERGLNTGLGDEGGFAPSLPSNRDALDLI
FT                   LVAIEKAGYTPGRDIALALDVAASEFYKDGAYQFEGKSRTASEMTDYYAELVDAYPLVS
FT                   IEDPLFEDDWDGWKILTDRLGTQVQIVGDDLFVTNPERLARGIAGGQANALLVKVNQIG
FT                   TLTETFDAVQLAHRNGYRCMMSHRSGETEDTTIADLAVAVDCGQIKTGAPARSDRVAKY
FT                   NQLLRIEEELDDAARYAGRSAFPRFTHEG"
     MASIEAINAR EILDSRGNPT VEVEVLLEDG SFARAAVPSG ASTGAFEAVE LRDGDAARYG        60
     GKGVERAVQG VLDEIYPAVV GEDASDQRLI DQAMIDLDAT PNKARLGANA LLGVSLAVAK       120
     AAAESAELPL FRYLGGPNAH TLPVPMMNIL NGGAHADSNV DIQEFMIAPI GAGSFREALR       180
     WGAEVYHALK SVLKERGLNT GLGDEGGFAP SLPSNRDALD LILVAIEKAG YTPGRDIALA       240
     LDVAASEFYK DGAYQFEGKS RTASEMTDYY AELVDAYPLV SIEDPLFEDD WDGWKILTDR       300
     LGTQVQIVGD DLFVTNPERL ARGIAGGQAN ALLVKVNQIG TLTETFDAVQ LAHRNGYRCM       360
     MSHRSGETED TTIADLAVAV DCGQIKTGAP ARSDRVAKYN QLLRIEEELD DAARYAGRSA       420
     FPRFTHEG                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page