(data stored in ACNUC7421 zone)

EMBL: CP001700.PE202

CP001700.PE202       Location/Qualifiers
FT   CDS             218877..219518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0202"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: sma:SAV_3532
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69157"
FT                   /db_xref="GOA:C7QJ15"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ15"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACU69157.1"
FT                   /translation="MKSAGSGSTPGRLSAVPTQRQDAASGTSRSSGDGGSGSGASAKRR
FT                   TRYTARAAILMLVVCALVLALAYPLQQYFSQSSQINQLKQQNAHKRTQVQQLGRQLTQW
FT                   QDPDYVKIQARLRLHYVFPGETGLRLLGAGDAATGGPDGTTGPSQGSSAWYAQLWNSVT
FT                   AASGAPTSSGAPTTPATSGASGSAGASGPSGTPTPSGGPARSATSPAPGH"
     MKSAGSGSTP GRLSAVPTQR QDAASGTSRS SGDGGSGSGA SAKRRTRYTA RAAILMLVVC        60
     ALVLALAYPL QQYFSQSSQI NQLKQQNAHK RTQVQQLGRQ LTQWQDPDYV KIQARLRLHY       120
     VFPGETGLRL LGAGDAATGG PDGTTGPSQG SSAWYAQLWN SVTAASGAPT SSGAPTTPAT       180
     SGASGSAGAS GPSGTPTPSG GPARSATSPA PGH                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page