(data stored in ACNUC7421 zone)

EMBL: CP001700.PE203

CP001700.PE203       Location/Qualifiers
FT   CDS             complement(219557..220213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0203"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: sma:SAV_4878 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69158"
FT                   /db_xref="GOA:C7QJ16"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ16"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69158.1"
FT                   /translation="MKESSAVRIMIAEDSAILRDGLVQILTKRGHEILAAVPNADELLA
FT                   AIAVGAPDAVVLDIRMPPTHTDEGLRAALELRRSHPKVGVLLFSQYVETRYARDLFSGQ
FT                   VSGVGYLLKERVADVSEFVEALAKIAAGGTVLDPEVVVQLLGSRPTDALTAREREVLGL
FT                   MAEGRSNAAIGKKLVLADSSVEKHISNIFTKLGLPPADEDHRRVLAVLKYLGVAP"
     MKESSAVRIM IAEDSAILRD GLVQILTKRG HEILAAVPNA DELLAAIAVG APDAVVLDIR        60
     MPPTHTDEGL RAALELRRSH PKVGVLLFSQ YVETRYARDL FSGQVSGVGY LLKERVADVS       120
     EFVEALAKIA AGGTVLDPEV VVQLLGSRPT DALTAREREV LGLMAEGRSN AAIGKKLVLA       180
     DSSVEKHISN IFTKLGLPPA DEDHRRVLAV LKYLGVAP                               218
//

If you have problems or comments...

PBIL Back to PBIL home page