(data stored in ACNUC7421 zone)

EMBL: CP001700.PE204

CP001700.PE204       Location/Qualifiers
FT   CDS             complement(220680..222020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0204"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   fal:FRAAL5519 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69159"
FT                   /db_xref="GOA:C7QJ17"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ17"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69159.1"
FT                   /translation="MGGGPKIGEAFPMKRFLLSPVSGRTARQYLFALVSAPLGLAGFVY
FT                   AVVTLAVGGALSFTFVGLPLIALAIHLARQYAKLQRRMARGLLGVDIEAPPPNLRRQNA
FT                   HGLLAKLGAALGDLPAWRSQLYLLVRFPLGIAYFVTLGVGVVEGLVMLTYPIWWAVFRP
FT                   TNTDSHGVKHQSALQFGDGFYFDNWLRALLLTVAGVVWIYAAVWILKFLLWLDSLLMKA
FT                   LLGPTNSERRVEELTVSRAHAVDDSAARLRRIERDLHDGAQAQLVALAMQLGEAKENLD
FT                   AGGNGAELDLTETRTLIDTAHRNAKQAINELRDLARGIHPAALDTGLRDALGTLAARSA
FT                   MPVTVNVALAERPDRAIETIAYFCAAELLTNAAKHAAPTRAALSVVQEEGQLHLTVEDD
FT                   GRGGAQVGYGGGLAGLLDRVRTVEGSLAVDSPQGGPTRVFVKLPMHV"
     MGGGPKIGEA FPMKRFLLSP VSGRTARQYL FALVSAPLGL AGFVYAVVTL AVGGALSFTF        60
     VGLPLIALAI HLARQYAKLQ RRMARGLLGV DIEAPPPNLR RQNAHGLLAK LGAALGDLPA       120
     WRSQLYLLVR FPLGIAYFVT LGVGVVEGLV MLTYPIWWAV FRPTNTDSHG VKHQSALQFG       180
     DGFYFDNWLR ALLLTVAGVV WIYAAVWILK FLLWLDSLLM KALLGPTNSE RRVEELTVSR       240
     AHAVDDSAAR LRRIERDLHD GAQAQLVALA MQLGEAKENL DAGGNGAELD LTETRTLIDT       300
     AHRNAKQAIN ELRDLARGIH PAALDTGLRD ALGTLAARSA MPVTVNVALA ERPDRAIETI       360
     AYFCAAELLT NAAKHAAPTR AALSVVQEEG QLHLTVEDDG RGGAQVGYGG GLAGLLDRVR       420
     TVEGSLAVDS PQGGPTRVFV KLPMHV                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page