(data stored in ACNUC7421 zone)

EMBL: CP001700.PE205

CP001700.PE205       Location/Qualifiers
FT   CDS             complement(222165..222395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69160"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69160.1"
FT                   /translation="MNVSATVKVRVTVDADKWAAASGVESVQASASLAAALSEALERFS
FT                   DLVPEVDQAGGETRVEKLTWTASTTDPALPS"
     MNVSATVKVR VTVDADKWAA ASGVESVQAS ASLAAALSEA LERFSDLVPE VDQAGGETRV        60
     EKLTWTASTT DPALPS                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page