(data stored in ACNUC7421 zone)

EMBL: CP001700.PE206

CP001700.PE206       Location/Qualifiers
FT   CDS             222455..224104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0206"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sgr:SGR_4708 putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69161"
FT                   /db_xref="GOA:C7QJ19"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030310"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ19"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69161.1"
FT                   /translation="MPTVAELIGVQSQHTGPGLLGPNGLRYQHPEIAAHAASRAALFGE
FT                   RHRPGMRPHIGVLLGNTDEFVFWLSAAALAGAALVGVNPTRRGAELARDIRHAECELLV
FT                   TDREHLPLLADLGLDALPLLIVDDPAYREALQPFAGVSATDVKPIAPITEDTRLLLYFT
FT                   SGSTGAPKAVTCVQGRVAASGAVMAERFGLIASDVCYIPMPMFHGNAILANWGPALVAG
FT                   ATVALRDRFSASGFLSDVREYQATYFTYVGRAISYILATPEHPEDAANPLRAGFGTEAG
FT                   PRDRERFEQRFGCHLSEGYGASEGGINIVAPRTFPPSVLARGAVVGKTNPTLSILNLET
FT                   GAPCPPAEFDAAGRLLNGAEAIGELVGTGPGGFTGYWNNPAADAERFADGRYRSGDLFY
FT                   ADTDGWLYFAARKADRMRVDGENISVALLEAILARWEPVEAVAAYAVPDEVTGDAVMCA
FT                   LVLRQGSDFDPGAFADFLAAQADLGTKMAPRFVRVTAALATTATEKVSRYAMREQGWWD
FT                   VGEDAVWARTGRQGAYQPRDTGSVNRNSAPPP"
     MPTVAELIGV QSQHTGPGLL GPNGLRYQHP EIAAHAASRA ALFGERHRPG MRPHIGVLLG        60
     NTDEFVFWLS AAALAGAALV GVNPTRRGAE LARDIRHAEC ELLVTDREHL PLLADLGLDA       120
     LPLLIVDDPA YREALQPFAG VSATDVKPIA PITEDTRLLL YFTSGSTGAP KAVTCVQGRV       180
     AASGAVMAER FGLIASDVCY IPMPMFHGNA ILANWGPALV AGATVALRDR FSASGFLSDV       240
     REYQATYFTY VGRAISYILA TPEHPEDAAN PLRAGFGTEA GPRDRERFEQ RFGCHLSEGY       300
     GASEGGINIV APRTFPPSVL ARGAVVGKTN PTLSILNLET GAPCPPAEFD AAGRLLNGAE       360
     AIGELVGTGP GGFTGYWNNP AADAERFADG RYRSGDLFYA DTDGWLYFAA RKADRMRVDG       420
     ENISVALLEA ILARWEPVEA VAAYAVPDEV TGDAVMCALV LRQGSDFDPG AFADFLAAQA       480
     DLGTKMAPRF VRVTAALATT ATEKVSRYAM REQGWWDVGE DAVWARTGRQ GAYQPRDTGS       540
     VNRNSAPPP                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page