(data stored in ACNUC7421 zone)

EMBL: CP001700.PE207

CP001700.PE207       Location/Qualifiers
FT   CDS             complement(224053..225753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0207"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sen:SACE_5293 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69162"
FT                   /db_xref="GOA:C7QJ20"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ20"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69162.1"
FT                   /translation="MIRGRFGRRTRLVAADQGFSAGAGTDAGAGASAGVAADASAGPNA
FT                   PFSTAPAFSAAPPTTQGSETYPARPNGQTAQSAPSALSRLGSPLSFWRRTPLRARLALA
FT                   ATVAVAAGIGGGVGFAYVAVRHSLTQQVDSGLQRQGAKVQDLLLTHHLPRYDETRSQQF
FT                   GDTLTNSQFIDSTGTPLQPKLLPATLRTPYSVVVLAPASTRVIPISSADAQVAAGSMNS
FT                   YMHSGEMNGQHVRILTLSIGQKDRALQIDAPLTAMDQQLSTLGWELFGAGAAGIVLAAG
FT                   LGWLVTRTALRPVAELTSTAERIAATHDLAHRIPIDGAPGEPRDELGRLAATFNTMLDA
FT                   VQEATDRQRQLVADASHELRTPLTSLRTNVEVLAHAQRLEPEDRQALVSGIMSGLDDMT
FT                   MLVSDTVELARGEEQAALFEELRFDLLVRRCVDRAAMHWPKAVFKEDLEDCLVVGVTDR
FT                   LAKAVRNLLDNAAKFSPDGGLVEVRTAPGADGTVTLTVRDHGPGIPEADLPHVFDRFYR
FT                   AASARDLPGSGLGLAIVAQVAVGHGGGVTVAGAQGGGAEFRLTLPVSRG"
     MIRGRFGRRT RLVAADQGFS AGAGTDAGAG ASAGVAADAS AGPNAPFSTA PAFSAAPPTT        60
     QGSETYPARP NGQTAQSAPS ALSRLGSPLS FWRRTPLRAR LALAATVAVA AGIGGGVGFA       120
     YVAVRHSLTQ QVDSGLQRQG AKVQDLLLTH HLPRYDETRS QQFGDTLTNS QFIDSTGTPL       180
     QPKLLPATLR TPYSVVVLAP ASTRVIPISS ADAQVAAGSM NSYMHSGEMN GQHVRILTLS       240
     IGQKDRALQI DAPLTAMDQQ LSTLGWELFG AGAAGIVLAA GLGWLVTRTA LRPVAELTST       300
     AERIAATHDL AHRIPIDGAP GEPRDELGRL AATFNTMLDA VQEATDRQRQ LVADASHELR       360
     TPLTSLRTNV EVLAHAQRLE PEDRQALVSG IMSGLDDMTM LVSDTVELAR GEEQAALFEE       420
     LRFDLLVRRC VDRAAMHWPK AVFKEDLEDC LVVGVTDRLA KAVRNLLDNA AKFSPDGGLV       480
     EVRTAPGADG TVTLTVRDHG PGIPEADLPH VFDRFYRAAS ARDLPGSGLG LAIVAQVAVG       540
     HGGGVTVAGA QGGGAEFRLT LPVSRG                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page