(data stored in ACNUC7421 zone)

EMBL: CP001700.PE209

CP001700.PE209       Location/Qualifiers
FT   CDS             complement(226478..227143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ22"
FT                   /inference="similar to AA sequence:KEGG:Acel_1453"
FT                   /protein_id="ACU69164.1"
FT                   /translation="MSDKPGGPAANDNNAEFELLSQAPSAPDISGQLKPARSGGAGIPK
FT                   VTLGLVGAVLLAGGFVGGIAVGKSNSSSSSKPSNTAAGANRARGGYGGGFGTGGATGGA
FT                   AGGTAGGATGGAAGGARGGAVTGTVTAVSGSTITVTDSTGKAVTVNTSPQTTVTIGKSG
FT                   AVSDLTTGSEVTILGTPDSSGTITARSVVSGITQFGFGGRGGNRTPGAASSSPGGSNG"
     MSDKPGGPAA NDNNAEFELL SQAPSAPDIS GQLKPARSGG AGIPKVTLGL VGAVLLAGGF        60
     VGGIAVGKSN SSSSSKPSNT AAGANRARGG YGGGFGTGGA TGGAAGGTAG GATGGAAGGA       120
     RGGAVTGTVT AVSGSTITVT DSTGKAVTVN TSPQTTVTIG KSGAVSDLTT GSEVTILGTP       180
     DSSGTITARS VVSGITQFGF GGRGGNRTPG AASSSPGGSN G                           221
//

If you have problems or comments...

PBIL Back to PBIL home page