(data stored in ACNUC7421 zone)

EMBL: CP001700.PE21

CP001700.PE21        Location/Qualifiers
FT   CDS             complement(22500..23396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0021"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: fal:FRAAL6347
FT                   putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68976"
FT                   /db_xref="GOA:C7QFN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68976.1"
FT                   /translation="MVHGRGHTVGMSPARSVLAEELGRRLRRHRLDLGLSGLEVAARAG
FT                   VTQPSVSKIERGMMLPSTEVLERVLGVLGLADEHRTDLRDLLTRAVDDAADRRRHGRGL
FT                   ALLDAIAERERNTTALRSFSTSMIPPLLQTADYARYAARLTPWMSERELGRASALHLER
FT                   QGVLFEQGRSFEFLLTESALRLCPGPPTLAATQADRLRVLSALPGVRIGIVPDSAAVSE
FT                   VFPLYGFTLHDDAAVAVETFTGELLLSRADEIAAHAAVLDGYAAGADYDLETATGLLTS
FT                   DRRPLASIPAPAGAGTG"
     MVHGRGHTVG MSPARSVLAE ELGRRLRRHR LDLGLSGLEV AARAGVTQPS VSKIERGMML        60
     PSTEVLERVL GVLGLADEHR TDLRDLLTRA VDDAADRRRH GRGLALLDAI AERERNTTAL       120
     RSFSTSMIPP LLQTADYARY AARLTPWMSE RELGRASALH LERQGVLFEQ GRSFEFLLTE       180
     SALRLCPGPP TLAATQADRL RVLSALPGVR IGIVPDSAAV SEVFPLYGFT LHDDAAVAVE       240
     TFTGELLLSR ADEIAAHAAV LDGYAAGADY DLETATGLLT SDRRPLASIP APAGAGTG         298
//

If you have problems or comments...

PBIL Back to PBIL home page