(data stored in ACNUC7421 zone)

EMBL: CP001700.PE210

CP001700.PE210       Location/Qualifiers
FT   CDS             complement(227177..228406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0210"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   saq:Sare_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69165"
FT                   /db_xref="GOA:C7QJ23"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ23"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACU69165.1"
FT                   /translation="MRFREVFRFAFAGLKANKLRSGLTTLGILIGVGAVILLVAVGKGS
FT                   GAQVQANIDKLGTNLLEVSRQAGGFGARASRNTGTQSSVSALTLADAQSLVDPVNAPDV
FT                   LTEAPVVTASPTATYSGATHQISQLVGTYPAYLQATNWQIAEGSSITDDDVTQARKVIV
FT                   IGQTVATDLFGTADPVGQQVMINNVPYSVEGVLQSKGSSGLQDADDFAIAPLTTVQDSL
FT                   SGFGSLSQIVVQAKSAGATTAAQNEITSILTSRHHLSATASPDFRVLNQQSLLATSSST
FT                   THTFTVLLGAVAAISLLVGGIGITNIMLVTVTERTREIGIRKALGAPRAAILGQFLIEA
FT                   VMLSLIGGALGVAAGLIGTRFTVAGVKPVIVPASIALAFAVSALIGLFFGSFPANRAAK
FT                   LHPIQALRHE"
     MRFREVFRFA FAGLKANKLR SGLTTLGILI GVGAVILLVA VGKGSGAQVQ ANIDKLGTNL        60
     LEVSRQAGGF GARASRNTGT QSSVSALTLA DAQSLVDPVN APDVLTEAPV VTASPTATYS       120
     GATHQISQLV GTYPAYLQAT NWQIAEGSSI TDDDVTQARK VIVIGQTVAT DLFGTADPVG       180
     QQVMINNVPY SVEGVLQSKG SSGLQDADDF AIAPLTTVQD SLSGFGSLSQ IVVQAKSAGA       240
     TTAAQNEITS ILTSRHHLSA TASPDFRVLN QQSLLATSSS TTHTFTVLLG AVAAISLLVG       300
     GIGITNIMLV TVTERTREIG IRKALGAPRA AILGQFLIEA VMLSLIGGAL GVAAGLIGTR       360
     FTVAGVKPVI VPASIALAFA VSALIGLFFG SFPANRAAKL HPIQALRHE                   409
//

If you have problems or comments...

PBIL Back to PBIL home page