(data stored in ACNUC7421 zone)

EMBL: CP001700.PE211

CP001700.PE211       Location/Qualifiers
FT   CDS             complement(228406..229176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0211"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: saq:Sare_0222 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69166"
FT                   /db_xref="GOA:C7QJ24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU69166.1"
FT                   /translation="MTGVSGPGGSEGRKPVIELADIRKTYGMDGTAVHALRGVTLTVPA
FT                   GDYVAIMGASGSGKSTMMNIIGCLDVPTSGRYLLDGIEVEHLSDRQLALVRNRKIGFVF
FT                   QSFNLLPRTTALDNVELPLIYAGVGTAERRKRARAALELVGLGDRMNHKPQELSGGQQQ
FT                   RVAVARALVTAPSLILADEPTGNLDSASSEDVMALFDRLHQAGRTIVLITHEHDIAEHA
FT                   DRAIRLMDGQIVSDERNGARGWLSAQHSAKHGSA"
     MTGVSGPGGS EGRKPVIELA DIRKTYGMDG TAVHALRGVT LTVPAGDYVA IMGASGSGKS        60
     TMMNIIGCLD VPTSGRYLLD GIEVEHLSDR QLALVRNRKI GFVFQSFNLL PRTTALDNVE       120
     LPLIYAGVGT AERRKRARAA LELVGLGDRM NHKPQELSGG QQQRVAVARA LVTAPSLILA       180
     DEPTGNLDSA SSEDVMALFD RLHQAGRTIV LITHEHDIAE HADRAIRLMD GQIVSDERNG       240
     ARGWLSAQHS AKHGSA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page