(data stored in ACNUC7421 zone)

EMBL: CP001700.PE212

CP001700.PE212       Location/Qualifiers
FT   CDS             complement(229173..230783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0212"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ace:Acel_1450 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69167"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ25"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACU69167.1"
FT                   /translation="MTDSPRLPKGVWINTSLAVVVAAGGAGAWALLGSSSSDKTAANGR
FT                   TIAVQRGNVTAQVSASGNVTLPTEQDLAFTASGTVTEVDVKPGDVVKAGQVLAKIDTTE
FT                   ANQQLTSAQAQLTTAQAQLTKLQQGQTPQQAALSRQQLTNAADSLSSAKTSYSDARNSI
FT                   SLDESNLAAAVTTAKNNLAADEAAAKPDAAKIAQDTNAVTQAENAQKNGSLKDTQSLHQ
FT                   AQNSLTSAQNSYAIAVDQQAVSAAPATPDQIASANQSVLNAQNAVTTAQKGVAGTVITA
FT                   PQAGTVLSVGGLVGDSVSAGSASSTSAASSSSGGSTGGSSGGSASGSSGSSSSSTSSTA
FT                   AKSGSSFVVLGNMSSLTVRAEFAETDAAKLKPGESAQVTINAIPGSALTATVQSVDPTS
FT                   TVVSNVVEYGVTLQFTAGQQDLASLKPGQTASVSVTTDSVTNVLYVPSSSVTTLAGQSF
FT                   VTIVSGKTQTQTPVQIGVVGDTSTEITSGVSEGDEVLLSSRTTTGTGTTTRGGGAGGFG
FT                   GGAGGFGGGAAGGRGGFGG"
     MTDSPRLPKG VWINTSLAVV VAAGGAGAWA LLGSSSSDKT AANGRTIAVQ RGNVTAQVSA        60
     SGNVTLPTEQ DLAFTASGTV TEVDVKPGDV VKAGQVLAKI DTTEANQQLT SAQAQLTTAQ       120
     AQLTKLQQGQ TPQQAALSRQ QLTNAADSLS SAKTSYSDAR NSISLDESNL AAAVTTAKNN       180
     LAADEAAAKP DAAKIAQDTN AVTQAENAQK NGSLKDTQSL HQAQNSLTSA QNSYAIAVDQ       240
     QAVSAAPATP DQIASANQSV LNAQNAVTTA QKGVAGTVIT APQAGTVLSV GGLVGDSVSA       300
     GSASSTSAAS SSSGGSTGGS SGGSASGSSG SSSSSTSSTA AKSGSSFVVL GNMSSLTVRA       360
     EFAETDAAKL KPGESAQVTI NAIPGSALTA TVQSVDPTST VVSNVVEYGV TLQFTAGQQD       420
     LASLKPGQTA SVSVTTDSVT NVLYVPSSSV TTLAGQSFVT IVSGKTQTQT PVQIGVVGDT       480
     STEITSGVSE GDEVLLSSRT TTGTGTTTRG GGAGGFGGGA GGFGGGAAGG RGGFGG           536
//

If you have problems or comments...

PBIL Back to PBIL home page