(data stored in ACNUC7421 zone)

EMBL: CP001700.PE213

CP001700.PE213       Location/Qualifiers
FT   CDS             230930..231601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_0266 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69168"
FT                   /db_xref="GOA:C7QJ26"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69168.1"
FT                   /translation="MPKIDWTPGQGKRGRPLRRVLGMGQQQGLLVMYGLAAIAVVLALA
FT                   AACGAFDGSGPQPSAQTAGESTNPDDPAGAPSIPKDSTKSTQILLGSVQHYADLLASGQ
FT                   KIVGTTHYPDMAAYAQAFADASSPAARFSKFRTSPNPESDTTYLNAERQAAAAYGGDHG
FT                   SRLDAWLRDMAKVKSDLGDWVATAAQYQQGAANQAVLDAAASTVNQDLATARDAANSLS
FT                   H"
     MPKIDWTPGQ GKRGRPLRRV LGMGQQQGLL VMYGLAAIAV VLALAAACGA FDGSGPQPSA        60
     QTAGESTNPD DPAGAPSIPK DSTKSTQILL GSVQHYADLL ASGQKIVGTT HYPDMAAYAQ       120
     AFADASSPAA RFSKFRTSPN PESDTTYLNA ERQAAAAYGG DHGSRLDAWL RDMAKVKSDL       180
     GDWVATAAQY QQGAANQAVL DAAASTVNQD LATARDAANS LSH                         223
//

If you have problems or comments...

PBIL Back to PBIL home page