(data stored in ACNUC7421 zone)

EMBL: CP001700.PE214

CP001700.PE214       Location/Qualifiers
FT   CDS             complement(231644..232222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0214"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mab:MAB_2246 thiol-specific antioxidant related
FT                   protein/peroxidoxin BcpB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69169"
FT                   /db_xref="GOA:C7QJ27"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ27"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU69169.1"
FT                   /translation="MHDIYTLPADLPIPQDDGAADHLPGARVPELTLTSTAGEAIALAA
FT                   LGEGRTVLYIYPLSGRPGEEAPEGWSAIPGARGCTTEACDFRDHHKELLEAGAARVFGL
FT                   SSQDSAYQQELVERLRLPFAMLSDTGLRLAAELDLPTFEAGGRLLYKRITLVIRDGVIE
FT                   HAFYPIFPPDRHAGEVLGWLTKNPVRRIP"
     MHDIYTLPAD LPIPQDDGAA DHLPGARVPE LTLTSTAGEA IALAALGEGR TVLYIYPLSG        60
     RPGEEAPEGW SAIPGARGCT TEACDFRDHH KELLEAGAAR VFGLSSQDSA YQQELVERLR       120
     LPFAMLSDTG LRLAAELDLP TFEAGGRLLY KRITLVIRDG VIEHAFYPIF PPDRHAGEVL       180
     GWLTKNPVRR IP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page