(data stored in ACNUC7421 zone)

EMBL: CP001700.PE215

CP001700.PE215       Location/Qualifiers
FT   CDS             complement(232341..233099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO7301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69170"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ28"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU69170.1"
FT                   /translation="MVKAFRPDDVVRVDGDVHAVLGSDVTWVVVKDGDAATLIDTGYPQ
FT                   DYDNLLASLALLGVAPESLSAILITHAHNDHIGGAERLRSTYGIPVLTHAEEVPHARRD
FT                   FLDQVSIGKVAANAWRPGVVPWALRALRSGGTADVPVAEPQAFPADGPLDLPGAPIPLH
FT                   TPGHTEGHCAYLLPAAGILVCGDALGTGHPTSRISGPQMLPTMFQKDRARALASLSVFE
FT                   GIDADVLVPGHGPVHRGAMRDVVQRVRERG"
     MVKAFRPDDV VRVDGDVHAV LGSDVTWVVV KDGDAATLID TGYPQDYDNL LASLALLGVA        60
     PESLSAILIT HAHNDHIGGA ERLRSTYGIP VLTHAEEVPH ARRDFLDQVS IGKVAANAWR       120
     PGVVPWALRA LRSGGTADVP VAEPQAFPAD GPLDLPGAPI PLHTPGHTEG HCAYLLPAAG       180
     ILVCGDALGT GHPTSRISGP QMLPTMFQKD RARALASLSV FEGIDADVLV PGHGPVHRGA       240
     MRDVVQRVRE RG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page