(data stored in ACNUC7421 zone)

EMBL: CP001700.PE216

CP001700.PE216       Location/Qualifiers
FT   CDS             complement(233220..235211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0216"
FT                   /product="cell wall binding repeat 2-containing protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69171"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ29"
FT                   /inference="similar to AA sequence:KEGG:Acel_1461"
FT                   /protein_id="ACU69171.1"
FT                   /translation="MSSPRIRSTAGSLAAAALLTLGATAYAPQASATGLPHHAARNGPI
FT                   TWAMNGPGVTGVDPVTGASIPGALVPALSSLNGTLSDLAWSPDGTKIAAVLTHGSNQQR
FT                   ALIAYSLIDQTVTTVEDGIPMLADPSWTADGSTILFAAAGGAQRNGLEVLWAISPVAGA
FT                   VEHRLLPNEPNCQEIEPSAGPGGAVVFTRTPYLTCDGGNGIGYSVNGHTTVIGQAQDFH
FT                   PALSPDGRTIVYCHQDVATGYYQLYRSAIVNGVPQPGTPLPGSPTMVTGDLVFSPDGSA
FT                   VAFHVFTGTGPQLATMPVAGGNPVYLSWPGASTGRLSWQPLFDKDVVRLYGDSRLATAV
FT                   SASRYTWADNGTADPARKQAKAAVISRSDNYADALGGAVLAARAGGPLLLTPTGTLDPA
FT                   VRAELDRILPAGAPVYVLGGGAAVSQTVENQLAGRYTVRREAGADRFATAVAVARASLA
FT                   LTPPSAGRVHVLAATGLNYPDALSAGAAAGALGTGVVVLTSDGQLPEVTRRFLADPTGT
FT                   GAAVDVDTIGGQAGSAIPDTSDVRLPAGSIVSAYSGTDRYETSYRVASVLLGDRQPTTA
FT                   GIVTAANWPDALAGGALLGVLRGPLLLYPSVPTSPTSLTDKWLRSNAATLRSVLILGGP
FT                   SALAPSTQRLIQGDIAAPGRSVYTENPY"
     MSSPRIRSTA GSLAAAALLT LGATAYAPQA SATGLPHHAA RNGPITWAMN GPGVTGVDPV        60
     TGASIPGALV PALSSLNGTL SDLAWSPDGT KIAAVLTHGS NQQRALIAYS LIDQTVTTVE       120
     DGIPMLADPS WTADGSTILF AAAGGAQRNG LEVLWAISPV AGAVEHRLLP NEPNCQEIEP       180
     SAGPGGAVVF TRTPYLTCDG GNGIGYSVNG HTTVIGQAQD FHPALSPDGR TIVYCHQDVA       240
     TGYYQLYRSA IVNGVPQPGT PLPGSPTMVT GDLVFSPDGS AVAFHVFTGT GPQLATMPVA       300
     GGNPVYLSWP GASTGRLSWQ PLFDKDVVRL YGDSRLATAV SASRYTWADN GTADPARKQA       360
     KAAVISRSDN YADALGGAVL AARAGGPLLL TPTGTLDPAV RAELDRILPA GAPVYVLGGG       420
     AAVSQTVENQ LAGRYTVRRE AGADRFATAV AVARASLALT PPSAGRVHVL AATGLNYPDA       480
     LSAGAAAGAL GTGVVVLTSD GQLPEVTRRF LADPTGTGAA VDVDTIGGQA GSAIPDTSDV       540
     RLPAGSIVSA YSGTDRYETS YRVASVLLGD RQPTTAGIVT AANWPDALAG GALLGVLRGP       600
     LLLYPSVPTS PTSLTDKWLR SNAATLRSVL ILGGPSALAP STQRLIQGDI AAPGRSVYTE       660
     NPY                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page