(data stored in ACNUC7421 zone)

EMBL: CP001700.PE217

CP001700.PE217       Location/Qualifiers
FT   CDS             complement(235340..237394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0217"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69172"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ30"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69172.1"
FT                   /translation="MSCPVLCLVVSLKDVSVPKPRAIRLATLAITGAALLVAGAAPALA
FT                   AGPGGRFGVSASASSAPAMSLSFGFYAGTSHAAAVLYAFNVDPAKEATTTYRIDWGDGS
FT                   TPWVQTGGTVPNGLVISHDYPHAGVWKATATVDDGTSTVGQNTTYTAHYPTTPTTPGSA
FT                   FTPVGGNAPLAGDLSIDGGTVDAAATKSYIVNWGDGSPSQTVAAADSGPTVVHHVFTAP
FT                   RSYGVSVVTTDGIDSSAPPLYPTAVSAWGLAFSSTVNTTAFATVTVTSSAGKSLPTYSD
FT                   YYMFSVNWGDGTTSPATQSEDMTHQYKTGGPYAVTVTMAPTMDADKSPAYTWTAGTTLV
FT                   VPTPPPPAPPAVGTRLVQRLGGLDRIGTGITVSRSGWSSWQNRFPYGGQLPAGAVVLAR
FT                   SDGFSDALAGVPLAAHVNGPLLLTGGSALDLTVEHEITRVLQPHAGKTVYLLGGTAALS
FT                   PAVQQRLVQLGYTVQRYSGLDRFGTALDIARRGLNDPAKIVVATGMDYPDALAAGPYAS
FT                   SVLGTSGHEAAVVLSQGGTLDPATAGYISSRLNSSSAQAPTVVTVGGAAGHAVDAAFPA
FT                   LAGHELKLQGQNRYQTANAVASQFTSASRVGVATGTGYADALTGGALAAARHFPIVLTT
FT                   PAGLDPAGREAIARFWSQLSGAYLFGGTTALSDQVLRDVDAVVNATAQP"
     MSCPVLCLVV SLKDVSVPKP RAIRLATLAI TGAALLVAGA APALAAGPGG RFGVSASASS        60
     APAMSLSFGF YAGTSHAAAV LYAFNVDPAK EATTTYRIDW GDGSTPWVQT GGTVPNGLVI       120
     SHDYPHAGVW KATATVDDGT STVGQNTTYT AHYPTTPTTP GSAFTPVGGN APLAGDLSID       180
     GGTVDAAATK SYIVNWGDGS PSQTVAAADS GPTVVHHVFT APRSYGVSVV TTDGIDSSAP       240
     PLYPTAVSAW GLAFSSTVNT TAFATVTVTS SAGKSLPTYS DYYMFSVNWG DGTTSPATQS       300
     EDMTHQYKTG GPYAVTVTMA PTMDADKSPA YTWTAGTTLV VPTPPPPAPP AVGTRLVQRL       360
     GGLDRIGTGI TVSRSGWSSW QNRFPYGGQL PAGAVVLARS DGFSDALAGV PLAAHVNGPL       420
     LLTGGSALDL TVEHEITRVL QPHAGKTVYL LGGTAALSPA VQQRLVQLGY TVQRYSGLDR       480
     FGTALDIARR GLNDPAKIVV ATGMDYPDAL AAGPYASSVL GTSGHEAAVV LSQGGTLDPA       540
     TAGYISSRLN SSSAQAPTVV TVGGAAGHAV DAAFPALAGH ELKLQGQNRY QTANAVASQF       600
     TSASRVGVAT GTGYADALTG GALAAARHFP IVLTTPAGLD PAGREAIARF WSQLSGAYLF       660
     GGTTALSDQV LRDVDAVVNA TAQP                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page