(data stored in ACNUC7421 zone)

EMBL: CP001700.PE218

CP001700.PE218       Location/Qualifiers
FT   CDS             237642..240188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0218"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; KEGG: ace:Acel_1679
FT                   protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69173"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ31"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACU69173.1"
FT                   /translation="MPFLAANARADTVAATVFVGSTSGAPCSDTAAAAGSAATPFCAIQ
FT                   PAIDSPLTGPGTTVLVAAGAAYLGQVNLDKSGTSADPIVLRSASPAQGSRAVIRGTVSV
FT                   NGAHDVTVDGFDIYADTFGVNIEASSDVVVTRDHIEGPHDSSVADSGIMIAMASSAVTV
FT                   STDFVRGFGGGGLFADSVSGLNIVADTITRNTTPSAGLDSIEVTGTSSGVAVADDIIDA
FT                   APSLPAGSAVDYNVIDAGAVGPHDITGDGLAGSTDGDITPGDTSPAIDSAEEAATGELP
FT                   TDMFGNAAADDPLVPNAGTGSRVRDRGAVERTHGDTSYVLTLTPASGDAPLAVTATVTE
FT                   HVGWAQQPRAAFYSFGFGGTEQPATANPTARHTYTTPLYGGDVSVTIYDSAHEAIGYTT
FT                   ALVNVGQPVHATLSVAAASGLNVNAVGSVQGGVGDWSIDFGDGYSTNFYSQTQATANHS
FT                   YAKPGTYKVTLTANGILPSNAAKLTQQVTVTAPPAPPPIVDTDPLVHRIAGSDRYATSI
FT                   VASQVRWSAANSVDGAPAEDQAQAVVLARGDAFPDALAGVPLAAYKHGPLLLTDPKTVS
FT                   QATLEEIRRVLPAGGNHTIYILGGKTAVSPSVEAELRGLGYNVVRYGGTDRYGTALLIA
FT                   HLGLGDPRHLIIAIGGDFADALAAGPFAADSAEVVDGKPAAILLSGKANGNDTITDAGT
FT                   AAYIDAKVQSNGGLSHCTDPNLITAVGGPALTAFLNQEHKATKYACVDGIVGADRYATS
FT                   SQLAGQWTNPEHPGVAVGTTFPDALSGGAYEASLGQPLLLTNPTSLPSSTATALASMYP
FT                   PHENTRTRSVVIFGGTSAVSSAVENQIIAKVHGRAQ"
     MPFLAANARA DTVAATVFVG STSGAPCSDT AAAAGSAATP FCAIQPAIDS PLTGPGTTVL        60
     VAAGAAYLGQ VNLDKSGTSA DPIVLRSASP AQGSRAVIRG TVSVNGAHDV TVDGFDIYAD       120
     TFGVNIEASS DVVVTRDHIE GPHDSSVADS GIMIAMASSA VTVSTDFVRG FGGGGLFADS       180
     VSGLNIVADT ITRNTTPSAG LDSIEVTGTS SGVAVADDII DAAPSLPAGS AVDYNVIDAG       240
     AVGPHDITGD GLAGSTDGDI TPGDTSPAID SAEEAATGEL PTDMFGNAAA DDPLVPNAGT       300
     GSRVRDRGAV ERTHGDTSYV LTLTPASGDA PLAVTATVTE HVGWAQQPRA AFYSFGFGGT       360
     EQPATANPTA RHTYTTPLYG GDVSVTIYDS AHEAIGYTTA LVNVGQPVHA TLSVAAASGL       420
     NVNAVGSVQG GVGDWSIDFG DGYSTNFYSQ TQATANHSYA KPGTYKVTLT ANGILPSNAA       480
     KLTQQVTVTA PPAPPPIVDT DPLVHRIAGS DRYATSIVAS QVRWSAANSV DGAPAEDQAQ       540
     AVVLARGDAF PDALAGVPLA AYKHGPLLLT DPKTVSQATL EEIRRVLPAG GNHTIYILGG       600
     KTAVSPSVEA ELRGLGYNVV RYGGTDRYGT ALLIAHLGLG DPRHLIIAIG GDFADALAAG       660
     PFAADSAEVV DGKPAAILLS GKANGNDTIT DAGTAAYIDA KVQSNGGLSH CTDPNLITAV       720
     GGPALTAFLN QEHKATKYAC VDGIVGADRY ATSSQLAGQW TNPEHPGVAV GTTFPDALSG       780
     GAYEASLGQP LLLTNPTSLP SSTATALASM YPPHENTRTR SVVIFGGTSA VSSAVENQII       840
     AKVHGRAQ                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page