(data stored in ACNUC7421 zone)

EMBL: CP001700.PE219

CP001700.PE219       Location/Qualifiers
FT   CDS             complement(241285..242544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0221"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sma:SAV_347
FT                   IS256 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69174"
FT                   /db_xref="GOA:C7Q0A6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C7Q0A6"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACU69174.1"
FT                   /translation="MILKEEDPMTALTSVPAGDDFERQLAAAEPDVLRAMVKSFAEALM
FT                   SAEADAACGAPYGQVSADRTNSRNGYRTRAWDTRVGSIELAVPKLRTGSYFPEWLLERR
FT                   RRAEQALMSVVATAYLLGVSTRRVERLAAELGVTQLSKSQVSAMAKHLDEQVAAFRNRP
FT                   LDAGPYPVLWIDALTQKVRENGRVVNVHALVAVGVNGDGGREILGIDVASAEDGAGWLA
FT                   FLRSLTARGLAGVQLVISDAHRGLVESIGAAIGGATWQRCRTHYARNLMNQVPKTAQPW
FT                   VATLLRTIFEQPDAEAVHAQAGQVIAALEAKFPKAAAHLDEARADLLAFTAFPHEIWRQ
FT                   IWSNNPQERLNKEIRRRTDVVGIFPDRASVIRLVGAVLAEQNDEWAEGRRYMGLEILAK
FT                   IQRTGQGPAPDTAPAAALIA"
     MILKEEDPMT ALTSVPAGDD FERQLAAAEP DVLRAMVKSF AEALMSAEAD AACGAPYGQV        60
     SADRTNSRNG YRTRAWDTRV GSIELAVPKL RTGSYFPEWL LERRRRAEQA LMSVVATAYL       120
     LGVSTRRVER LAAELGVTQL SKSQVSAMAK HLDEQVAAFR NRPLDAGPYP VLWIDALTQK       180
     VRENGRVVNV HALVAVGVNG DGGREILGID VASAEDGAGW LAFLRSLTAR GLAGVQLVIS       240
     DAHRGLVESI GAAIGGATWQ RCRTHYARNL MNQVPKTAQP WVATLLRTIF EQPDAEAVHA       300
     QAGQVIAALE AKFPKAAAHL DEARADLLAF TAFPHEIWRQ IWSNNPQERL NKEIRRRTDV       360
     VGIFPDRASV IRLVGAVLAE QNDEWAEGRR YMGLEILAKI QRTGQGPAPD TAPAAALIA        419
//

If you have problems or comments...

PBIL Back to PBIL home page