(data stored in ACNUC7421 zone)

EMBL: CP001700.PE22

CP001700.PE22        Location/Qualifiers
FT   CDS             23568..24164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0022"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sco:SCO2347 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68977"
FT                   /db_xref="GOA:C7QFN8"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN8"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ACU68977.1"
FT                   /translation="MSLTALLTAFGVVFLAELPDKTAIASLILGARYRPSWVFAGVAAA
FT                   FVVHVALAVAAGSLLTLVPRRPLEAIVAVLFLGGAVLMLRSHGREAGEEEAEEAPDLGD
FT                   DAGFGKVAGTAFGVIMVAEFGDLTQIVTANLAAKFADPLAVGLGATLGLWAVGGLAIVG
FT                   GRSLLKVLPLHLIVRLAALVMVVLAGVSLWQAVAG"
     MSLTALLTAF GVVFLAELPD KTAIASLILG ARYRPSWVFA GVAAAFVVHV ALAVAAGSLL        60
     TLVPRRPLEA IVAVLFLGGA VLMLRSHGRE AGEEEAEEAP DLGDDAGFGK VAGTAFGVIM       120
     VAEFGDLTQI VTANLAAKFA DPLAVGLGAT LGLWAVGGLA IVGGRSLLKV LPLHLIVRLA       180
     ALVMVVLAGV SLWQAVAG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page