(data stored in ACNUC7421 zone)

EMBL: CP001700.PE220

CP001700.PE220       Location/Qualifiers
FT   CDS             complement(242678..244198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_1496 large integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69175"
FT                   /db_xref="GOA:C7QJ33"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69175.1"
FT                   /translation="MTHFQSATPPTASGSHSTPPTPGWLSVGAERADPQDCSEGGCVGD
FT                   YSAPTDLFCRKHDRFLPLSSRLPSRRKTIAINLSRLVVLGGFEYSAQYATNVPLVVLGA
FT                   VLGGLLLVLPLRRFPHTYAAAVRAWAVGGLVCGLAAIPDVTLHRVLGTAVLVIVLGGAT
FT                   LYLGRLASLIGVGDPRIPDQIAPRRAARQHAGRQAALGTPGRVAGLVVGPAVASPAAIL
FT                   TLLALGQGPAQWLFRAPSAIQVFLVTTAIGGPVATLFIAAVAGFLEGAPKVDRQVAPKF
FT                   PEPFAPPRFVLDTVPDGSLGRVASRTVEITVNAVRRAAHVLATSTVRTANWMHRHAVII
FT                   GRKVAATAQCALGILRNAAVIAGYAAMCAVRIVVLPAVGIGAAYALLVPSGSALTRYLL
FT                   SGGFADLGLGIAGAIALAASVMLVWMLLSGLSRDRVLDSATHNVEDLWARVMVLIATGG
FT                   LALGTLGSLGYGKIHIGFVTLSVDAVVAFTVLKGYARTSIPWRRNVTK"
     MTHFQSATPP TASGSHSTPP TPGWLSVGAE RADPQDCSEG GCVGDYSAPT DLFCRKHDRF        60
     LPLSSRLPSR RKTIAINLSR LVVLGGFEYS AQYATNVPLV VLGAVLGGLL LVLPLRRFPH       120
     TYAAAVRAWA VGGLVCGLAA IPDVTLHRVL GTAVLVIVLG GATLYLGRLA SLIGVGDPRI       180
     PDQIAPRRAA RQHAGRQAAL GTPGRVAGLV VGPAVASPAA ILTLLALGQG PAQWLFRAPS       240
     AIQVFLVTTA IGGPVATLFI AAVAGFLEGA PKVDRQVAPK FPEPFAPPRF VLDTVPDGSL       300
     GRVASRTVEI TVNAVRRAAH VLATSTVRTA NWMHRHAVII GRKVAATAQC ALGILRNAAV       360
     IAGYAAMCAV RIVVLPAVGI GAAYALLVPS GSALTRYLLS GGFADLGLGI AGAIALAASV       420
     MLVWMLLSGL SRDRVLDSAT HNVEDLWARV MVLIATGGLA LGTLGSLGYG KIHIGFVTLS       480
     VDAVVAFTVL KGYARTSIPW RRNVTK                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page