(data stored in ACNUC7421 zone)

EMBL: CP001700.PE221

CP001700.PE221       Location/Qualifiers
FT   CDS             complement(244269..246128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69176"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69176.1"
FT                   /translation="MNQASVHSVLDQLARLGPLRVAFLSGAGVSVEMPTGLPSGAALTR
FT                   RVCEAFFPERTFDTLLDYHAAVGWTITEVCAAQRARAGGIAPKGRLPRLETVLGVAMRV
FT                   LDHDERRVLRILDDVRTAVPNRQHAALAAHLAVGGRQLTLNFDDCIEQRLITLEAPPDA
FT                   ADRLIHLHSSFRADPEGRSLGLTLARIEPGFQKPVEHSLTSTLAAAAAIVVVGYSGSDF
FT                   FDVDQTVAALPSGSLKGTRLYWINHGSHPRWHVIDAANPALPPVIAGLARAGARPTVLC
FT                   GRTGEFLSSLLDAWRLNSGPEPAVSAGPPAPPPTVPVSENERREAALALYRELAIPRAV
FT                   AGILDSGNLAGLPSDAVWLARSELLWEQGRWNDLLHQWLRRTPEGIDPLVRAERVGACL
FT                   WVQGRLVPAYLWLVAHRRAAAVDPDGARRLAETEGRVVEHMARTPELRPIARCLAPQAV
FT                   GRIRALGGLEQQAGVHAFRRRQDLTSSLDAIGGGGVREAGHAAASQNWFAEAGSLTAAL
FT                   SYRHRQLRDEFRPDRPDEELAADYRELADRFDIVGSAAGRVRTCLLPGAERVFGVREFV
FT                   SALFDGQFGWWHRCRLLGHYLPSRVGHIARSALTIRQGRDPRL"
     MNQASVHSVL DQLARLGPLR VAFLSGAGVS VEMPTGLPSG AALTRRVCEA FFPERTFDTL        60
     LDYHAAVGWT ITEVCAAQRA RAGGIAPKGR LPRLETVLGV AMRVLDHDER RVLRILDDVR       120
     TAVPNRQHAA LAAHLAVGGR QLTLNFDDCI EQRLITLEAP PDAADRLIHL HSSFRADPEG       180
     RSLGLTLARI EPGFQKPVEH SLTSTLAAAA AIVVVGYSGS DFFDVDQTVA ALPSGSLKGT       240
     RLYWINHGSH PRWHVIDAAN PALPPVIAGL ARAGARPTVL CGRTGEFLSS LLDAWRLNSG       300
     PEPAVSAGPP APPPTVPVSE NERREAALAL YRELAIPRAV AGILDSGNLA GLPSDAVWLA       360
     RSELLWEQGR WNDLLHQWLR RTPEGIDPLV RAERVGACLW VQGRLVPAYL WLVAHRRAAA       420
     VDPDGARRLA ETEGRVVEHM ARTPELRPIA RCLAPQAVGR IRALGGLEQQ AGVHAFRRRQ       480
     DLTSSLDAIG GGGVREAGHA AASQNWFAEA GSLTAALSYR HRQLRDEFRP DRPDEELAAD       540
     YRELADRFDI VGSAAGRVRT CLLPGAERVF GVREFVSALF DGQFGWWHRC RLLGHYLPSR       600
     VGHIARSALT IRQGRDPRL                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page