(data stored in ACNUC7421 zone)

EMBL: CP001700.PE223

CP001700.PE223       Location/Qualifiers
FT   CDS             247117..249495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0225"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; NB-ARC domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69178"
FT                   /db_xref="GOA:C7QJ36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ36"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69178.1"
FT                   /translation="MCGSAGTVGGDVDANREIAAQLKSWRERRHLSQANLADRINVSRS
FT                   HYTRLERGERPLHPVLADALDKALDTGGLFQNLREGSAADPSQHRSSDAASPGESSDRG
FT                   PFVPFPNTVHFTGRADEVQAVCQTLTGQLGHPRAAGICVISGMPGIGKTALARCVAHLL
FT                   ADRFPDGCLCLDLQGFAPGVTPLTDFDALGLVLAMLGVPDEQIPAGRQARVVRYHREIA
FT                   GRRLLLLLDDAVCAQQISCLMPPTAGCSVLVTSRNRLTALDDAHRVVLPVLPPEQAAEL
FT                   FCAVAEYRGGDQTSIDGILAACGGVPLALRIVAARCRPDSGLTPADLAARLAHPRSRLT
FT                   HLADNERAVSDAFGASLDLLPSAQRRLFLLLGLHPAKPLSGWAAAALADIPAEQAERGL
FT                   EELVGASLLEPRGHGRFRVHDLLAEFAASAVRRELPATEIWAATGRMLDAYAVTAEAAD
FT                   RLLTPYRHRLSATEGAATGSPPQTFEDDEHARSWLTDHLDTLSALCVLAATDGWDERSW
FT                   QLAYSLRGVFFLGRHWRLWRATHEAALPAAVRAGNRIGTGMTLANLGFVLGETHDFEAA
FT                   MTHLGAAVEVFRDIGDRHGEFTAQSHLAWIQHCTGDYREALAGQTAALEFRQAVGTPRN
FT                   VAIIMRDMAATELALGKHGEARDHLQTAVAMFTELGLRLDLTMALNGLGELAVHEGDTL
FT                   QADVHHYAALNAARRSGSVFEQARAHAGLGRCAVRRGRPARARHQLTRALRLYDTLGAG
FT                   HVAAAVHAELAALDGAGISAARTRTPGTPSAPSAPGQTR"
     MCGSAGTVGG DVDANREIAA QLKSWRERRH LSQANLADRI NVSRSHYTRL ERGERPLHPV        60
     LADALDKALD TGGLFQNLRE GSAADPSQHR SSDAASPGES SDRGPFVPFP NTVHFTGRAD       120
     EVQAVCQTLT GQLGHPRAAG ICVISGMPGI GKTALARCVA HLLADRFPDG CLCLDLQGFA       180
     PGVTPLTDFD ALGLVLAMLG VPDEQIPAGR QARVVRYHRE IAGRRLLLLL DDAVCAQQIS       240
     CLMPPTAGCS VLVTSRNRLT ALDDAHRVVL PVLPPEQAAE LFCAVAEYRG GDQTSIDGIL       300
     AACGGVPLAL RIVAARCRPD SGLTPADLAA RLAHPRSRLT HLADNERAVS DAFGASLDLL       360
     PSAQRRLFLL LGLHPAKPLS GWAAAALADI PAEQAERGLE ELVGASLLEP RGHGRFRVHD       420
     LLAEFAASAV RRELPATEIW AATGRMLDAY AVTAEAADRL LTPYRHRLSA TEGAATGSPP       480
     QTFEDDEHAR SWLTDHLDTL SALCVLAATD GWDERSWQLA YSLRGVFFLG RHWRLWRATH       540
     EAALPAAVRA GNRIGTGMTL ANLGFVLGET HDFEAAMTHL GAAVEVFRDI GDRHGEFTAQ       600
     SHLAWIQHCT GDYREALAGQ TAALEFRQAV GTPRNVAIIM RDMAATELAL GKHGEARDHL       660
     QTAVAMFTEL GLRLDLTMAL NGLGELAVHE GDTLQADVHH YAALNAARRS GSVFEQARAH       720
     AGLGRCAVRR GRPARARHQL TRALRLYDTL GAGHVAAAVH AELAALDGAG ISAARTRTPG       780
     TPSAPSAPGQ TR                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page