(data stored in ACNUC7421 zone)

EMBL: CP001700.PE224

CP001700.PE224       Location/Qualifiers
FT   CDS             249492..250529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_5148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69179"
FT                   /db_xref="GOA:C7QJ37"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69179.1"
FT                   /translation="MSPQKTGVPPGEFDIFLSLGGPDRVEANLLKEALVKEGLTVFIDE
FT                   DDIRHFDGITREIERCLRSSRALLAYYSREYPLRSACQFELTAALLAGRNEQDPTRRII
FT                   VVNPEATEDHIQPAYISDARFAVRPGSDHERKALAALIKQKVDTLEGPLSSIAFTRRPR
FT                   WFAFRIAGAPGFVGRYRELWELDSLLTKAALPLTQDTPFGPVAVVTGAARVGKSSLVAD
FT                   YAWQFGAAFRGGVYWIDMSGVEGTADQVLAAYADRVRSSAAIAGLDVAGLSRERMFGVL
FT                   GDHLAATAEPSLWIVDGLPAGLGEQAPHRMIIPAGDRVQTVFVGRRDPFGGAIRAMVLG
FT                   GLSRG"
     MSPQKTGVPP GEFDIFLSLG GPDRVEANLL KEALVKEGLT VFIDEDDIRH FDGITREIER        60
     CLRSSRALLA YYSREYPLRS ACQFELTAAL LAGRNEQDPT RRIIVVNPEA TEDHIQPAYI       120
     SDARFAVRPG SDHERKALAA LIKQKVDTLE GPLSSIAFTR RPRWFAFRIA GAPGFVGRYR       180
     ELWELDSLLT KAALPLTQDT PFGPVAVVTG AARVGKSSLV ADYAWQFGAA FRGGVYWIDM       240
     SGVEGTADQV LAAYADRVRS SAAIAGLDVA GLSRERMFGV LGDHLAATAE PSLWIVDGLP       300
     AGLGEQAPHR MIIPAGDRVQ TVFVGRRDPF GGAIRAMVLG GLSRG                       345
//

If you have problems or comments...

PBIL Back to PBIL home page