(data stored in ACNUC7421 zone)

EMBL: CP001700.PE225

CP001700.PE225       Location/Qualifiers
FT   CDS             250633..252387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5075 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69180.1"
FT                   /translation="MLAGGRLQDRQGLRSHAEVLADFDGVADIDRFFGVLVRESIGELD
FT                   TARTLVLAVASVCAAAGIPAGLLVRAVATLANGAIDASAVGDALRGLQAAGLAANDDGR
FT                   WSISAVARELAREQNPPGPRRQYLRTVVADALTPMLQDAATSLGDRPGLVTHAVRLCGE
FT                   ADRSEDARWLAILLERLAEHYEARGEAASSAVYRDRLLDIRGENTSDLFYAARAAQAAR
FT                   EFDKAAGLAQRALSGAGSDEPQFRRCRLLLAEALDGALRFQEAETYWEHVAASAGDRDA
FT                   GESTGRAAESVAYARSRIRRGELRRAKQALKLLIEEYARSSGDVEFTTADAVGGQIRGA
FT                   RIEYAHVLALIGDQIEARRVASELVAIYREAGLLRHADMVRAQEILAEAKLVPHIRELR
FT                   LDDTARARAEQDMKQLWQKNREEDGPRSPSALFAGVGYGHALVSQGRKEKARDMLVGLR
FT                   ADAIAVGGPRDPAYLRATFLLGQAYAQMRCYRKALKMFRYAYANQQEILGPAHPYTLAS
FT                   GFELAVMYKTVGEDTEAAKLIREQDALSAKSMEYSNDLRAQIKVAGSLIALIPSPLWRW
FT                   MRGPERDC"
     MLAGGRLQDR QGLRSHAEVL ADFDGVADID RFFGVLVRES IGELDTARTL VLAVASVCAA        60
     AGIPAGLLVR AVATLANGAI DASAVGDALR GLQAAGLAAN DDGRWSISAV ARELAREQNP       120
     PGPRRQYLRT VVADALTPML QDAATSLGDR PGLVTHAVRL CGEADRSEDA RWLAILLERL       180
     AEHYEARGEA ASSAVYRDRL LDIRGENTSD LFYAARAAQA AREFDKAAGL AQRALSGAGS       240
     DEPQFRRCRL LLAEALDGAL RFQEAETYWE HVAASAGDRD AGESTGRAAE SVAYARSRIR       300
     RGELRRAKQA LKLLIEEYAR SSGDVEFTTA DAVGGQIRGA RIEYAHVLAL IGDQIEARRV       360
     ASELVAIYRE AGLLRHADMV RAQEILAEAK LVPHIRELRL DDTARARAEQ DMKQLWQKNR       420
     EEDGPRSPSA LFAGVGYGHA LVSQGRKEKA RDMLVGLRAD AIAVGGPRDP AYLRATFLLG       480
     QAYAQMRCYR KALKMFRYAY ANQQEILGPA HPYTLASGFE LAVMYKTVGE DTEAAKLIRE       540
     QDALSAKSME YSNDLRAQIK VAGSLIALIP SPLWRWMRGP ERDC                        584
//

If you have problems or comments...

PBIL Back to PBIL home page