(data stored in ACNUC7421 zone)

EMBL: CP001700.PE226

CP001700.PE226       Location/Qualifiers
FT   CDS             252889..255201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0228"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: sen:SACE_0488 SARP family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69181"
FT                   /db_xref="GOA:C7QJ39"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ39"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69181.1"
FT                   /translation="MRPEWDRYAQRLKALRSEQGLSQRRLARALHVDHSVISRAESAVR
FT                   RPDPDLAASIDLLLSTGGELQRLARDAVRKQASADSLSTRGGPSGAVPRLRSSIPPDSV
FT                   HFTGRNAEFDQVRSELVERPDAVGAASVCVISALAGVGKTALAIHSAHRLAGRFPDGCL
FT                   FLDLRGFTPGHAPLSSFEALGALLALLDVPVATIHSTEPARSAQFQAETAGARLLLVLD
FT                   NAADAHQVRLLLPSAPGCRVLVTSRNRLVALDEAVHLDLRPLAEVDAAALFRMVSAGGR
FT                   VSQSTVDGIVARCAGVPLALRIAAARCAPGGAFDPELLAAELSRAEDFIGQLDDGERSV
FT                   RAVFDASFSLLPRELRQVLALLGTRLLTVFDIWDVAMLADLPLLGAAGALERLHAASLL
FT                   EVRGTDRFVLHDLVAEYAISAAGQTLGAEQLRAAIGRLLDAYLRVCDRADSQVTPHRHR
FT                   FPLAVAAAGAVPDPDFSDYYEALDWQTKHLDTAAALCETAYEHGFDEQCWQLAYALRGV
FT                   FFLTKHWEQWDRIQRIALAATRRLQDPHAECVTLNNLGLILGERGETDAAHRCLNEAES
FT                   VCRAARDRFGENTARAHRAWLFHTAGRHGESLTEHEGVLEFYTQIDSPRNVAIVMRDMA
FT                   ASEAALGHTDSALAHLHAAEQAFRKLDLTMDLAMALNDLGETYTAIIDPKRAAEYFEAA
FT                   LAACAESGSDHERARAHAGLGALAESAGRQNWANAHYLQALRLFDALGAPAADVVRARL
FT                   HASTVMFPTTAEEDENR"
     MRPEWDRYAQ RLKALRSEQG LSQRRLARAL HVDHSVISRA ESAVRRPDPD LAASIDLLLS        60
     TGGELQRLAR DAVRKQASAD SLSTRGGPSG AVPRLRSSIP PDSVHFTGRN AEFDQVRSEL       120
     VERPDAVGAA SVCVISALAG VGKTALAIHS AHRLAGRFPD GCLFLDLRGF TPGHAPLSSF       180
     EALGALLALL DVPVATIHST EPARSAQFQA ETAGARLLLV LDNAADAHQV RLLLPSAPGC       240
     RVLVTSRNRL VALDEAVHLD LRPLAEVDAA ALFRMVSAGG RVSQSTVDGI VARCAGVPLA       300
     LRIAAARCAP GGAFDPELLA AELSRAEDFI GQLDDGERSV RAVFDASFSL LPRELRQVLA       360
     LLGTRLLTVF DIWDVAMLAD LPLLGAAGAL ERLHAASLLE VRGTDRFVLH DLVAEYAISA       420
     AGQTLGAEQL RAAIGRLLDA YLRVCDRADS QVTPHRHRFP LAVAAAGAVP DPDFSDYYEA       480
     LDWQTKHLDT AAALCETAYE HGFDEQCWQL AYALRGVFFL TKHWEQWDRI QRIALAATRR       540
     LQDPHAECVT LNNLGLILGE RGETDAAHRC LNEAESVCRA ARDRFGENTA RAHRAWLFHT       600
     AGRHGESLTE HEGVLEFYTQ IDSPRNVAIV MRDMAASEAA LGHTDSALAH LHAAEQAFRK       660
     LDLTMDLAMA LNDLGETYTA IIDPKRAAEY FEAALAACAE SGSDHERARA HAGLGALAES       720
     AGRQNWANAH YLQALRLFDA LGAPAADVVR ARLHASTVMF PTTAEEDENR                  770
//

If you have problems or comments...

PBIL Back to PBIL home page