(data stored in ACNUC7421 zone)

EMBL: CP001700.PE227

CP001700.PE227       Location/Qualifiers
FT   CDS             complement(255268..258165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0229"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: fre:Franean1_4251
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69182"
FT                   /db_xref="GOA:C7QJ40"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ40"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU69182.1"
FT                   /translation="MTAPVRDGGENEAVYDVFFSYSWKNLAEALILVAALEARRLQVFR
FT                   DETGMRDFDDIGTEVFAALAGSRSFVALYTPQFPESAYCRLELAHAMTAAYRLDGDVRR
FT                   ILPVVRELPYEAVRPRALQDKRLPARSTGPDALAAVVAERLEEIDDRPFGIASEPGPPN
FT                   WYPFPTVAEPAFHGRATELWDLHDALAGRDDAAQPGQRLARIVGMGGQGKTMLAEQYAR
FT                   WFAADHPGGVFVLRGFGSHRNANSSPALLRTALEQQLARIAEELPGVPAEVEGRSADRS
FT                   ARSVIRDHLERADQDYLWIVDDLPDHVGPIGVREFLAPTARGRTLVTSRHAHRGFVGET
FT                   VELGPLGESAAVRILLGGAGARADRATIASARRLAADLGHHAMAVALVARTLDNNGTAE
FT                   LDQVRTELADPDRDALEWAAAREHEIATDHQGSVAAAMMRSLARLSSAAYEVLLLASIL
FT                   AAAPVPAAMFDSVLGDSRRLDSTRPGMTVDDALRECAALALATVTVGTFGTLWSVHSLV
FT                   SRAVRFRDRFGSGDREQLRARSVEALGEILERGRDGIVDYLPHVRAVAGGATDVAQQSL
FT                   LNEAGRVQVGLGDERAALAMFERLYQACRESLGEDDFATQAGLVGLGVAYGLLGQHELA
FT                   LDFKTRAYEVLARVEGADEEATLTALNNVAVTFGELGDYAKARVLHRQIYATHLKRRGP
FT                   SHPATLASLNAYATARELDGHESLALRLRTRVVAASRRYLRPDDPQLADAISSLAVSHY
FT                   RAGNSAAARALFQEAYDVRRAIYGPSHPDALSALEFAAVCADPEARTAELRAVYRKRVT
FT                   HADPGSPAARRTLRNLIINLRSVHVSTANPPSDSVNRVFSEPVQEPPGDWTEVAVRLDD
FT                   ETTDERVEDFELASYLHGALVAEFGTDHPETLFAETCLGHATVCLGQLDSQIDDGLNVL
FT                   RDAAEGMRVVLGCPEADLAVVDRLIDWAERLAFDD"
     MTAPVRDGGE NEAVYDVFFS YSWKNLAEAL ILVAALEARR LQVFRDETGM RDFDDIGTEV        60
     FAALAGSRSF VALYTPQFPE SAYCRLELAH AMTAAYRLDG DVRRILPVVR ELPYEAVRPR       120
     ALQDKRLPAR STGPDALAAV VAERLEEIDD RPFGIASEPG PPNWYPFPTV AEPAFHGRAT       180
     ELWDLHDALA GRDDAAQPGQ RLARIVGMGG QGKTMLAEQY ARWFAADHPG GVFVLRGFGS       240
     HRNANSSPAL LRTALEQQLA RIAEELPGVP AEVEGRSADR SARSVIRDHL ERADQDYLWI       300
     VDDLPDHVGP IGVREFLAPT ARGRTLVTSR HAHRGFVGET VELGPLGESA AVRILLGGAG       360
     ARADRATIAS ARRLAADLGH HAMAVALVAR TLDNNGTAEL DQVRTELADP DRDALEWAAA       420
     REHEIATDHQ GSVAAAMMRS LARLSSAAYE VLLLASILAA APVPAAMFDS VLGDSRRLDS       480
     TRPGMTVDDA LRECAALALA TVTVGTFGTL WSVHSLVSRA VRFRDRFGSG DREQLRARSV       540
     EALGEILERG RDGIVDYLPH VRAVAGGATD VAQQSLLNEA GRVQVGLGDE RAALAMFERL       600
     YQACRESLGE DDFATQAGLV GLGVAYGLLG QHELALDFKT RAYEVLARVE GADEEATLTA       660
     LNNVAVTFGE LGDYAKARVL HRQIYATHLK RRGPSHPATL ASLNAYATAR ELDGHESLAL       720
     RLRTRVVAAS RRYLRPDDPQ LADAISSLAV SHYRAGNSAA ARALFQEAYD VRRAIYGPSH       780
     PDALSALEFA AVCADPEART AELRAVYRKR VTHADPGSPA ARRTLRNLII NLRSVHVSTA       840
     NPPSDSVNRV FSEPVQEPPG DWTEVAVRLD DETTDERVED FELASYLHGA LVAEFGTDHP       900
     ETLFAETCLG HATVCLGQLD SQIDDGLNVL RDAAEGMRVV LGCPEADLAV VDRLIDWAER       960
     LAFDD                                                                   965
//

If you have problems or comments...

PBIL Back to PBIL home page