(data stored in ACNUC7421 zone)

EMBL: CP001700.PE228

CP001700.PE228       Location/Qualifiers
FT   CDS             complement(258162..259667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69183"
FT                   /db_xref="GOA:C7QJ41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ41"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU69183.1"
FT                   /translation="MAGLDPQERPAGSVPRADQIERMMRRITDGHLRSTGRELTQAAVA
FT                   RYFGVSAETVRSWFSGRRNPGPDRVRDLARFAGVSPIEAFVDAGWLDESDVDPGRSGAG
FT                   GGGDQMYAPEAAVHALLHDETMRARYAVRLLALESHGSYPLTTDVAAQFLLIPGAAVPA
FT                   LADVERLAGMARIVPSPSAAMLRRHPDYCAVRLELAAFVAEPLRWFGQYSWQGDAGSQT
FT                   WRPAADRWPAQILVQDIVSGRSTEAAADGWSCRDQRPLVLIGGRYSSSMAAAMLAGALG
FT                   WQFVLVHSGTVIDRSGQVVATRRDWLSGPAEAWREVAEHVGRSHAAGRPWPAVLAARPH
FT                   SFLTPDGSPDHGALEQLRRTPARIVYARPHEAVLDWWTERQIGLSCEREYKSTALALRK
FT                   QIEAGFDHIEEALRARAETISAERGREDLTIRCRRPSGALDPLRPQIPDGLVDDQVRLA
FT                   WRSLTWLGHTSRHAAELPTRTPRSGPLRRFKRLLEADQEASLS"
     MAGLDPQERP AGSVPRADQI ERMMRRITDG HLRSTGRELT QAAVARYFGV SAETVRSWFS        60
     GRRNPGPDRV RDLARFAGVS PIEAFVDAGW LDESDVDPGR SGAGGGGDQM YAPEAAVHAL       120
     LHDETMRARY AVRLLALESH GSYPLTTDVA AQFLLIPGAA VPALADVERL AGMARIVPSP       180
     SAAMLRRHPD YCAVRLELAA FVAEPLRWFG QYSWQGDAGS QTWRPAADRW PAQILVQDIV       240
     SGRSTEAAAD GWSCRDQRPL VLIGGRYSSS MAAAMLAGAL GWQFVLVHSG TVIDRSGQVV       300
     ATRRDWLSGP AEAWREVAEH VGRSHAAGRP WPAVLAARPH SFLTPDGSPD HGALEQLRRT       360
     PARIVYARPH EAVLDWWTER QIGLSCEREY KSTALALRKQ IEAGFDHIEE ALRARAETIS       420
     AERGREDLTI RCRRPSGALD PLRPQIPDGL VDDQVRLAWR SLTWLGHTSR HAAELPTRTP       480
     RSGPLRRFKR LLEADQEASL S                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page