(data stored in ACNUC7421 zone)

EMBL: CP001700.PE229

CP001700.PE229       Location/Qualifiers
FT   CDS             259902..260978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0231"
FT                   /product="clavaminate synthase"
FT                   /note="KEGG: kra:Krad_3958 clavaminate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69184"
FT                   /db_xref="GOA:C7QJ42"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR014503"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="PDB:6F2A"
FT                   /db_xref="PDB:6F2B"
FT                   /db_xref="PDB:6F2E"
FT                   /db_xref="PDB:6F6J"
FT                   /db_xref="UniProtKB/Swiss-Prot:C7QJ42"
FT                   /inference="similar to AA sequence:KEGG:Krad_3958"
FT                   /protein_id="ACU69184.1"
FT                   /translation="MKNLSAYEVYESPKTSGESRTEAVSEAAFESDPEVSAILVLTSSE
FT                   ASTLERVADLVTAHALYAAHDFCAQAQLAAAELPSRVVARLQEFAWGDMNEGHLLIKGL
FT                   PQVRSLPPTPTSNVHAVAATTPMSRYQALINECVGRMIAYEAEGHGHTFQDMVPSAMSA
FT                   HSQTSLGSAVELELHTEQAFSPLRPDFVSLACLRGDPRALTYLFSARQLVATLTTQEIA
FT                   MLREPMWTTTVDESFLAEGRTFLLGFERGPIPILSGADDDPFIVFDQDLMRGISAPAQE
FT                   LQQTVIRAYYAERVSHCLAPGEMLLIDNRRAVHGRSIFAPRFDGADRFLSRSFIVADGS
FT                   RSRHARSSFGRVVSARFS"
     MKNLSAYEVY ESPKTSGESR TEAVSEAAFE SDPEVSAILV LTSSEASTLE RVADLVTAHA        60
     LYAAHDFCAQ AQLAAAELPS RVVARLQEFA WGDMNEGHLL IKGLPQVRSL PPTPTSNVHA       120
     VAATTPMSRY QALINECVGR MIAYEAEGHG HTFQDMVPSA MSAHSQTSLG SAVELELHTE       180
     QAFSPLRPDF VSLACLRGDP RALTYLFSAR QLVATLTTQE IAMLREPMWT TTVDESFLAE       240
     GRTFLLGFER GPIPILSGAD DDPFIVFDQD LMRGISAPAQ ELQQTVIRAY YAERVSHCLA       300
     PGEMLLIDNR RAVHGRSIFA PRFDGADRFL SRSFIVADGS RSRHARSSFG RVVSARFS         358
//

If you have problems or comments...

PBIL Back to PBIL home page