(data stored in ACNUC7421 zone)

EMBL: CP001700.PE23

CP001700.PE23        Location/Qualifiers
FT   CDS             complement(24190..24807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_2766
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68978"
FT                   /db_xref="GOA:C7QFN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU68978.1"
FT                   /translation="MSNRDDLLAGAKKCLLEKGYSRTTARDIAQASGVSLAAIGYHFGS
FT                   KDALMNEAMFQAIGEWGDHLEEAFAKAGPNLSVQERFARVFDDVSATFDENQALWMASF
FT                   ELIIEIDRIPGARDMFRKAIPEARTGLANLILGIPEEDVDKDMEMGAGAVLYSLMAGLL
FT                   IQRFADTGQTPTGADLARGLRQLADVLEADVLKSSDKAAAVS"
     MSNRDDLLAG AKKCLLEKGY SRTTARDIAQ ASGVSLAAIG YHFGSKDALM NEAMFQAIGE        60
     WGDHLEEAFA KAGPNLSVQE RFARVFDDVS ATFDENQALW MASFELIIEI DRIPGARDMF       120
     RKAIPEARTG LANLILGIPE EDVDKDMEMG AGAVLYSLMA GLLIQRFADT GQTPTGADLA       180
     RGLRQLADVL EADVLKSSDK AAAVS                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page